Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP4 antibody - C-terminal region (ARP30180_P050)

Product Specifications

Gene Name

FK506 binding protein 4, 59kDa

Gene Aliases

HBI, p52, Hsp56, FKBP51, FKBP52, FKBP59, PPIase

Gene ID

2288

Swiss Prot

P30416

Accession Number

NP_002005

Reactivity

Human, Pig

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FKBP4

Target

FKBP4 is a component of unactivated mammalian steroid receptor complexes that sediment at 8-10 S. It may have a rotamase activity. FKBP4 may play a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors.The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It has high structural and functional similarity to FK506-binding protein 1A (FKBP1A), but unlike FKBP1A, this protein does not have immunosuppressant activity when complexed with FK506. It interacts with interferon regulatory factor-4 and plays an important role in immunoregulatory gene expression in B and T lymphocytes. This encoded protein is known to associate with phytanoyl-CoA alpha-hydroxylase. It can also associate with two heat shock proteins (hsp90 and hsp70) and thus may play a role in the intracellular trafficking of hetero-oligomeric forms of the steroid hormone receptors. This protein correlates strongly with adeno-associated virus type 2 vectors (AAV) resulting in a significant increase in AAV-mediated transgene expression in human cell lines. Thus this encoded protein is thought to have important implications for the optimal use of AAV vectors in human gene therapy. This gene has been found to have multiple polyadenylation sites. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

HSP90AB1; HSP90AA1; RPS10-NUDT3; CDC37L1; LSM7; CACYBP; CHORDC1; GLMN; CDC37; SUGT1; USP19; PTGES3; AHSA1; UBC; MDM2; MGEA5; TPM3; MCM4; MCM3; SQSTM1; Nr3c1; S100A6; S100A2; S100A1; gag-pol; VCAM1; TAF9; SNCA; SARDH; UBD; PGR; NR3C2; AR; CDK2; SIRT7; SH3B

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA

Applications

WB, IHC

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Human: 100%; Pig: 75%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

52kDa

Protein Length

459

NCBI Gene Symbol

FKBP4

Host or Source

Rabbit

Protein Name

Peptidyl-prolyl cis-trans isomerase FKBP4

Gene Name URL

FKBP4

CAS Number

9007-83-4

Nucleotide Accession Number

NM_002014

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GSR Peptide (AAP54344)
AAP54344-100UG 100 µg

GSR Peptide (AAP54344)

Ask
View Details
C22orf36 (LRRC75B) (NM_207644) Human Tagged Lenti ORF Clone
RC219736L3 10 µg

C22orf36 (LRRC75B) (NM_207644) Human Tagged Lenti ORF Clone

Ask
View Details
Mouse Monoclonal PBX1 Antibody (PCRP-PBX1-3C8) [DyLight 550]
NBP3-14035R 0.1 mL

Mouse Monoclonal PBX1 Antibody (PCRP-PBX1-3C8) [DyLight 550]

Ask
View Details
Granzyme B (C11, CTLA-1, Cathepsin G-like 1, CTSGL1, Cytotoxic T-lymphocyte Proteinase 2, Lymphocyte Protease, Fragmentin-2, Granzyme-2, Human Lymphocyte Protein, HLP, SECT, T-cell Serine Protease 1-3E, GZMB, CGL1, CSPB, CTLA1, GRB) (FITC)
MBS6380212-01 0.1 mL

Granzyme B (C11, CTLA-1, Cathepsin G-like 1, CTSGL1, Cytotoxic T-lymphocyte Proteinase 2, Lymphocyte Protease, Fragmentin-2, Granzyme-2, Human Lymphocyte Protein, HLP, SECT, T-cell Serine Protease 1-3E, GZMB, CGL1, CSPB, CTLA1, GRB) (FITC)

Ask
View Details
Granzyme B (C11, CTLA-1, Cathepsin G-like 1, CTSGL1, Cytotoxic T-lymphocyte Proteinase 2, Lymphocyte Protease, Fragmentin-2, Granzyme-2, Human Lymphocyte Protein, HLP, SECT, T-cell Serine Protease 1-3E, GZMB, CGL1, CSPB, CTLA1, GRB) (FITC)
MBS6380212-02 5x 0.1 mL

Granzyme B (C11, CTLA-1, Cathepsin G-like 1, CTSGL1, Cytotoxic T-lymphocyte Proteinase 2, Lymphocyte Protease, Fragmentin-2, Granzyme-2, Human Lymphocyte Protein, HLP, SECT, T-cell Serine Protease 1-3E, GZMB, CGL1, CSPB, CTLA1, GRB) (FITC)

Ask
View Details
Mouse Mir6416 qPCR Primer Pair
QM80530S 200 Tests

Mouse Mir6416 qPCR Primer Pair

Ask
View Details