Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFBR2/TGF-beta RII, Rhesus Macaque (HEK293, Fc)

TGFBR2/TGF-beta RII Protein collaborates with TGFBR1 to form a dedicated receptor for TGFB1, TGFB2, and TGFB3. It serves as a signal transducer, orchestrating diverse physiological and pathological processes, including cell cycle regulation, mesenchymal cell dynamics, wound healing, matrix production, immunosuppression, and carcinogenesis. Upon cytokine binding, the receptor complex activates TGFBR1 through TGFBR2 phosphorylation, initiating the canonical SMAD-dependent TGF-beta signaling cascade. Additionally, TGFBR2 participates in non-canonical, SMAD-independent pathways. TGFBR2/TGF-beta RII Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived TGFBR2/TGF-beta RII protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TGFBR2/TGF-beta RII Protein, Rhesus Macaque (HEK293, Fc), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tgfbr2-tgf-beta-rii-protein-rhesus-macaque-hek293-fc.html

Purity

97.00

Smiles

IPPHVQKSVNNDMMVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCLSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD

Molecular Formula

703088 (Gene_ID) NP_001248080.1 (I24-D159) (Accession)

Molecular Weight

Approximately 50-70 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Chicken Protein RER1 (RER1), partial
MBS7086519 Inquire

Recombinant Chicken Protein RER1 (RER1), partial

Ask
View Details
Human CCDC19 knockout cell line
ABC-KH2518 1 Vial

Human CCDC19 knockout cell line

Ask
View Details
Lentiviral mouse Slc6a13 shRNA (UAS) - Lentiviral mouse Slc6a13 shRNA (UAS, GFP) plasmid
GTR15207454 1 Vial

Lentiviral mouse Slc6a13 shRNA (UAS) - Lentiviral mouse Slc6a13 shRNA (UAS, GFP) plasmid

Ask
View Details
Dog Pulmonary surfactant-associated protein A ELISA Kit
MBS2882289-01 48 Well

Dog Pulmonary surfactant-associated protein A ELISA Kit

Ask
View Details
Dog Pulmonary surfactant-associated protein A ELISA Kit
MBS2882289-02 96 Well

Dog Pulmonary surfactant-associated protein A ELISA Kit

Ask
View Details
Dog Pulmonary surfactant-associated protein A ELISA Kit
MBS2882289-03 5x 96 Well

Dog Pulmonary surfactant-associated protein A ELISA Kit

Ask
View Details