Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL7, Cynomolgus/Rhesus Macaque (HEK293, Fc)

CXCL7 (also known as neutrophil activating peptide 2, NAP-2) is a platelet-derived growth factor that belongs to the ELR+ CXC chemokine family, functioning as a potent chemoattractant and activator of neutrophils through binding to its receptor CXCR2[1]. CXCL7 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is produced in HEK293 cells with a N-Terminal Fc-tag. It consists of 70 amino acids (T59-D128) .

Product Specifications

Product Name Alternative

CXCL7 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc), Rhesus Macaque; Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcl7-protein-cynomolgus-hek293-fc.html

Purity

98.00

Smiles

TELRCLCMKTTSGIHPKNIQSLEVIGKGIHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

Molecular Formula

703334/102124735 (Gene_ID) F6SCP6/XP_005555138.1 (T59-D128) (Accession)

Molecular Weight

Approximately 38 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Qian Guo, et al. CXCL7 promotes proliferation and invasion of cholangiocarcinoma cells. Oncol Rep. 2017 Feb;37 (2) :1114-1122.|[2]Yu-Shan Wang, et al. Canine CXCL7 and its functional expression in dendritic cells undergoing maturation. Vet Immunol Immunopathol. 2010 May 15;135 (1-2) :128-136.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

AAV Blank Control Virus (CMV) (Amp)(Serotype 8)
AAVP008a 3 x 100 μl

AAV Blank Control Virus (CMV) (Amp)(Serotype 8)

Ask
View Details
Recombinant Mycobacterium leprae Phosphoribosylformylglycinamidine synthase 2 (purL), partial
MBS1372489 Inquire

Recombinant Mycobacterium leprae Phosphoribosylformylglycinamidine synthase 2 (purL), partial

Ask
View Details
Rabbit Polyclonal EAAT1/GLAST-1/SLC1A3 Antibody [Alexa Fluor 488]
NB100-1869AF488 0.1 mL

Rabbit Polyclonal EAAT1/GLAST-1/SLC1A3 Antibody [Alexa Fluor 488]

Ask
View Details
Anti-Human HIGD1A/HIG-1 Antibody (SAA1922)
MBS1570882-01 0.1 mg

Anti-Human HIGD1A/HIG-1 Antibody (SAA1922)

Ask
View Details
Anti-Human HIGD1A/HIG-1 Antibody (SAA1922)
MBS1570882-02 1 mg

Anti-Human HIGD1A/HIG-1 Antibody (SAA1922)

Ask
View Details
Anti-Human HIGD1A/HIG-1 Antibody (SAA1922)
MBS1570882-03 5x 1 mg

Anti-Human HIGD1A/HIG-1 Antibody (SAA1922)

Ask
View Details