Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis C virus genotype 1a Genome polyprotein, partial

Product Specifications

Product Name Alternative

Genome polyprotein [Cleaved into: Core protein p21; Capsid protein C; p21) ; Core protein p19; Envelope glycoprotein E1; gp32; gp35) ; Envelope glycoprotein E2; NS1; gp68; gp70) ; p7; Protease NS2-3; p23; EC 3.4.22.-) ; Serine protease NS3; EC 3.4.21.98; EC 3.6.1.15; EC 3.6.4.13; Hepacivirin; NS3P; p70) ; Non-structural protein 4A; NS4A; p8) ; Non-structural protein 4B; NS4B; p27) ; Non-structural protein 5A; NS5A; p56) ; RNA-directed RNA polymerase; EC 2.7.7.48; NS5B; p68) ]

Abbreviation

Recombinant Hepatitis C virus genotype 1a Genome polyprotein, partial

UniProt

P26664

Expression Region

192-325aa

Organism

Hepatitis C virus genotype 1a (isolate 1) (HCV)

Target Sequence

YQVRNSTGLYHVTNDCPNSSIVYEAADAILHTPGCVPCVREGNASRCWVAMTPTVATRDGKLPATQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRRHWTTQGCNCSIYPGHITGHRMAWDMMMN

Tag

C-terminal 6xHis-Myc-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Capsid proteins VP1, VP2, and VP3 form a closed capsid enclosing the viral positive strand RNA genome. All these proteins contain a beta-sheet structure called beta-barrel jelly roll. Together they form an icosahedral capsid (T=3) composed of 60 copies of each VP1, VP2, and VP3, with a diameter of approximately 300 Angstroms. VP1 is situated at the 12 fivefold axes, whereas VP2 and VP3 are located at the quasi-sixfold axes. The capsid interacts with HAVCR1 to provide virion attachment to target cell.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Core protein packages viral RNA to form a viral nucleocapsid, and promotes virion budding. Modulates viral translation initiation by interacting with HCV IRES and 40S ribosomal subunit. Also regulates many host cellular functions such as signaling pathways and apoptosis. Prevents the establishment of cellular antiviral state by blocking the interferon-alpha/beta (IFN-alpha/beta) and IFN-gamma signaling pathways and by inducing human STAT1 degradation. Thought to play a role in virus-mediated cell transformation leading to hepatocellular carcinomas. Interacts with, and activates STAT3 leading to cellular transformation. May repress the promoter of p53, and sequester CREB3 and SP110 isoform 3/Sp110b in the cytoplasm. Also represses cell cycle negative regulating factor CDKN1A, thereby interrupting an important check point of normal cell cycle regulation. Targets transcription factors involved in the regulation of inflammatory responses and in the immune response

Molecular Weight

18.7 kDa

References & Citations

Genetic relatedness of hepatitis A virus strains recovered from different geographical regions.Robertson B.H., Jansen R.W., Khanna B., Totsuka A., Nainan O.V., Siegl G., Widell A., Margolis H.S., Isomura S., Ito K., Ishizu T., Moritsugu Y., Lemon S.M.J. Gen. Virol. 73:1365-1377 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

WDR4 Human Gene Knockout Kit (CRISPR)
KN402931 1 Kit

WDR4 Human Gene Knockout Kit (CRISPR)

Ask
View Details
DEFA1 AAV siRNA Pooled Vector
17884161 1.0 μg

DEFA1 AAV siRNA Pooled Vector

Ask
View Details
BMI1 Mouse Monoclonal
MBS767146-01 0.1 mg

BMI1 Mouse Monoclonal

Ask
View Details
BMI1 Mouse Monoclonal
MBS767146-02 5x 0.1 mg

BMI1 Mouse Monoclonal

Ask
View Details
RETNB Antibody
C45852-01 50 µL

RETNB Antibody

Ask
View Details
RETNB Antibody
C45852-02 100 µL

RETNB Antibody

Ask
View Details