Recombinant Human Neuronal acetylcholine receptor subunit alpha-3 (CHRNA3), partial
Product Specifications
Product Name Alternative
ACHA3_HUMAN; AChR; Cholinergic receptor neuronal nicotinic alpha polypeptide 3; Cholinergic receptor nicotinic alpha 3; Cholinergic receptor nicotinic alpha polypeptide 3; CHRNA 3; CHRNA3; LNCR2; MGC104879; NACHRA 3; NACHRA3; Neuronal acetylcholine receptor protein alpha 3 chain precursor; Neuronal acetylcholine receptor subunit alpha 3; Neuronal acetylcholine receptor subunit alpha-3; Neuronal nicotinic acetylcholine receptor alpha 3 subunit; PAOD2
Abbreviation
Recombinant Human CHRNA3 protein, partial
Gene Name
CHRNA3
UniProt
P32297
Expression Region
32-240aa
Organism
Homo sapiens (Human)
Target Sequence
SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
Tag
C-terminal 10xHis-tagged
Type
Developed Protein
Source
Baculovirus
Field of Research
Others
Relevance
Bordetella pertussis is the causative agent of whooping cough. An essential step in the disease process is the attachment of the bacteria to the ciliated epithelium of the respiratory tract, enabling the organism to resist normal host-clearance mechanisms. It is unclear which bacterial cell surface component are responsible for adherence but the fimbriae of B.pertussis are prime candidates for being involved in this process.
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Molecular Weight
26.6 kDa
References & Citations
"Structure of the Bordetella pertussis gene coding for the serotype 3 fimbrial subunit." Mooi F.R., Ter Avest A., van der Heide H.G.J. FEMS Microbiol. Lett. 54:327-331 (1990)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Extracellular Domain
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items