Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Apolipoprotein C-III (APOC3)

Product Specifications

Product Name Alternative

Apolipoprotein C3

Abbreviation

Recombinant Cynomolgus monkey APOC3 protein

Gene Name

APOC3

UniProt

P18659

Expression Region

21-99aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

SEAEDTSLLGFMQGYMQHATKTAKDALTSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKLSGFWDLNPEAKPTLAEAA

Tag

N-terminal MBP-tagged and C-terminal 6xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Cardiovascular

Relevance

Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs) . Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs) . Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners.

Molecular Weight

52.7 kDa

References & Citations

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-ERp5 Antibody
E38QA1526 100ug/100ul

Anti-ERp5 Antibody

Ask
View Details
IL22RA2 Protein Vector (Rat) (pPM-C-HA)
24866026 500 ng

IL22RA2 Protein Vector (Rat) (pPM-C-HA)

Ask
View Details
MemGlow NR4A Membrane Polarity Probe ex 553  em 637  50-300 slides  (MEMBRIGHT Family Probe)
MG06 50-300 Slides

MemGlow NR4A Membrane Polarity Probe ex 553 em 637 50-300 slides (MEMBRIGHT Family Probe)

Ask
View Details
MAGEA8 protein (His tag)
80R-4184 20 ug

MAGEA8 protein (His tag)

Ask
View Details
PCSK1N sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
36232111 3 x 1.0 µg

PCSK1N sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Ask
View Details
STAT5A (Ab-780) Antibody
E021049-1 50μg/50μl

STAT5A (Ab-780) Antibody

Ask
View Details