Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin

Product Specifications

Product Name Alternative

RRNA N-glycosidase (Alpha-TCS)

Abbreviation

Recombinant Trichosanthes kirilowii rRNA N-glycosidase protein

UniProt

P09989

Expression Region

24-270aa

Organism

Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)

Target Sequence

DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Inactivates eukaryotic 60S ribosomal subunits.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inactivates eukaryotic 60S ribosomal subunits.

Molecular Weight

30.8 kDa

References & Citations

"The C-terminal fragment of the ribosomal P protein complexed to trichosanthin reveals the interaction between the ribosome-inactivating protein and the ribosome." Too P.H., Ma M.K., Mak A.N., Wong Y.T., Tung C.K., Zhu G., Au S.W., Wong K.B., Shaw P.C. Nucleic Acids Res. 37:602-610 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

EEF1A2 Rabbit pAb
E2502473 100ul

EEF1A2 Rabbit pAb

Ask
View Details
Galectin-1/LGALS1 (8A12) Mouse Monoclonal Antibody
CST 40103S 100 µL

Galectin-1/LGALS1 (8A12) Mouse Monoclonal Antibody

Ask
View Details
CD59 (CD59 Glycoprotein, 1F5 Antigen, 20kD Homologous Restriction Factor, HRF-20, HRF20, MAC-inhibitory Protein, MAC-IP, MEM43 Antigen, Membrane Attack Complex Inhibition Factor, MACIF, Membrane Inhibitor of Reactive Lysis, MIRL, Protectin, MIC11, MIN1, M
MBS6373180-01 0.1 mL

CD59 (CD59 Glycoprotein, 1F5 Antigen, 20kD Homologous Restriction Factor, HRF-20, HRF20, MAC-inhibitory Protein, MAC-IP, MEM43 Antigen, Membrane Attack Complex Inhibition Factor, MACIF, Membrane Inhibitor of Reactive Lysis, MIRL, Protectin, MIC11, MIN1, M

Ask
View Details
CD59 (CD59 Glycoprotein, 1F5 Antigen, 20kD Homologous Restriction Factor, HRF-20, HRF20, MAC-inhibitory Protein, MAC-IP, MEM43 Antigen, Membrane Attack Complex Inhibition Factor, MACIF, Membrane Inhibitor of Reactive Lysis, MIRL, Protectin, MIC11, MIN1, M
MBS6373180-02 5x 0.1 mL

CD59 (CD59 Glycoprotein, 1F5 Antigen, 20kD Homologous Restriction Factor, HRF-20, HRF20, MAC-inhibitory Protein, MAC-IP, MEM43 Antigen, Membrane Attack Complex Inhibition Factor, MACIF, Membrane Inhibitor of Reactive Lysis, MIRL, Protectin, MIC11, MIN1, M

Ask
View Details
IL6 Mouse Monoclonal Antibody [Clone ID: LBI12E5]
AMM21287VCF 100 µg

IL6 Mouse Monoclonal Antibody [Clone ID: LBI12E5]

Ask
View Details
Recombinant Escherichia coli O9:H4 GTPase Era (era)
MBS1181410-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O9:H4 GTPase Era (era)

Ask
View Details