Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Herpes simplex virus type 2 ICP47 protein (US12)

Product Specifications

Product Name Alternative

Immediate-early protein IE12 (Immediate-early-5) (Infected cell protein 47) (US12 protein) (Vmw12)

Abbreviation

Recombinant Herpes simplex virus type 2 US12 protein

Gene Name

US12

UniProt

P60504

Expression Region

1-78aa

Organism

Herpes simplex virus type 2 (strain SA8) (Simian agent 8)

Target Sequence

MSSLYLATVDAFLRNPHTRHRTCADLRRELDAYADEERREAAKAIAHPDRPLLAPPSAPPNHSHLAARETAPPPAATP

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Plays a role in the inhibition of host immune response. Binds specifically to transporters associated with antigen processing, thereby blocking peptide-binding and translocation by TAP as well as subsequent loading of peptides onto MHC class I molecules. Empty MHC I molecules are retained in the endoplasmic reticulum and ultimately directed to proteasomal degradation. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a role in the inhibition of host immune response. Binds specifically to transporters associated with antigen processing (TAP), thereby blocking peptide-binding and translocation by TAP as well as subsequent loading of peptides onto MHC class I molecules. Empty MHC I molecules are retained in the endoplasmic reticulum and ultimately directed to proteasomal degradation. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes.

Molecular Weight

23.9 kDa

References & Citations

"Identification of an ICP47 homolog in Simian agent 8 (SA8) ." Bigger J.E., Martin D.W. Submitted (SEP-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Polyclonal Antibody to Regenerating Islet Derived Protein 3 Gamma (REG3g)
PAE676Mu01-01 20 µL

Polyclonal Antibody to Regenerating Islet Derived Protein 3 Gamma (REG3g)

Ask
View Details
Polyclonal Antibody to Regenerating Islet Derived Protein 3 Gamma (REG3g)
PAE676Mu01-02 100 µL

Polyclonal Antibody to Regenerating Islet Derived Protein 3 Gamma (REG3g)

Ask
View Details
Polyclonal Antibody to Regenerating Islet Derived Protein 3 Gamma (REG3g)
PAE676Mu01-03 200 µL

Polyclonal Antibody to Regenerating Islet Derived Protein 3 Gamma (REG3g)

Ask
View Details
Polyclonal Antibody to Regenerating Islet Derived Protein 3 Gamma (REG3g)
PAE676Mu01-04 1 mL

Polyclonal Antibody to Regenerating Islet Derived Protein 3 Gamma (REG3g)

Ask
View Details
Mouse Monoclonal FGF-22 Antibody (MM0286-4F28) [Alexa Fluor 532]
NBP2-12300AF532 0.1 mL

Mouse Monoclonal FGF-22 Antibody (MM0286-4F28) [Alexa Fluor 532]

Ask
View Details
GENLISA™ Mouse Aryl Hydrocarbon Receptor Nuclear Translocator 2 (ARNT2) ELISA
KLM5170 96 Well

GENLISA™ Mouse Aryl Hydrocarbon Receptor Nuclear Translocator 2 (ARNT2) ELISA

Ask
View Details