Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Retinoblastoma-like protein 2 (RBL2), partial

Product Specifications

Product Name Alternative

130 kDa retinoblastoma-associated protein (p130) (Retinoblastoma-related protein 2) (RBR-2) (pRb2) (RB2)

Abbreviation

Recombinant Human RBL2 protein, partial

Gene Name

RBL2

UniProt

Q08999

Expression Region

417-616aa

Organism

Homo sapiens (Human)

Target Sequence

TPVSTATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVVTFSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKPESPLWEKIRDNENRV

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Key regulator of entry into cell division. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases KMT5B and KMT5C, leading to epigenetic transcriptional repression. Controls histone H4 'Lys-20' trimethylation. Probably acts as a transcription repressor by recruiting chromatin-modifying enzymes to promoters. Potent inhibitor of E2F-mediated trans-activation, associates preferentially with E2F5. Binds to cyclins A and E. Binds to and may be involved in the transforming capacity of the adenovirus E1A protein. May act as a tumor suppressor.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Key regulator of entry into cell division. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases KMT5B and KMT5C, leading to epigenetic transcriptional repression. Controls histone H4 'Lys-20' trimethylation. Probably acts as a transcription repressor by recruiting chromatin-modifying enzymes to promoters. Potent inhibitor of E2F-mediated trans-activation, associates preferentially with E2F5. Binds to cyclins A and E. Binds to and may be involved in the transforming capacity of the adenovirus E1A protein. May act as a tumor suppressor.

Molecular Weight

27.4 kDa

References & Citations

"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal anti-human Alpha-fetoprotein (AFP)
hAP-1129A 50 µg

Mouse Monoclonal anti-human Alpha-fetoprotein (AFP)

Ask
View Details
Tesamorelin
A018-02 2 mg

Tesamorelin

Ask
View Details
RAB3C (NM_138453) Human Mass Spec Standard
PH301436 10 µg

RAB3C (NM_138453) Human Mass Spec Standard

Ask
View Details
MART-1 / Melan-A Antibody
V7772-20UG 20 µg

MART-1 / Melan-A Antibody

Ask
View Details
OGG1 (N-glycosylase/DNA Lyase, 8-oxoguanine DNA Glycosylase, DNA-(Apurinic or Apyrimidinic Site) Lyase, AP Lyase, MMH, MUTM, OGH1) (MaxLight 490)
MBS6387948-01 0.1 mL

OGG1 (N-glycosylase/DNA Lyase, 8-oxoguanine DNA Glycosylase, DNA-(Apurinic or Apyrimidinic Site) Lyase, AP Lyase, MMH, MUTM, OGH1) (MaxLight 490)

Ask
View Details
OGG1 (N-glycosylase/DNA Lyase, 8-oxoguanine DNA Glycosylase, DNA-(Apurinic or Apyrimidinic Site) Lyase, AP Lyase, MMH, MUTM, OGH1) (MaxLight 490)
MBS6387948-02 5x 0.1 mL

OGG1 (N-glycosylase/DNA Lyase, 8-oxoguanine DNA Glycosylase, DNA-(Apurinic or Apyrimidinic Site) Lyase, AP Lyase, MMH, MUTM, OGH1) (MaxLight 490)

Ask
View Details