Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transformer-2 protein homolog beta (TRA2B), partial

Product Specifications

Product Name Alternative

Splicing factor, arginine/serine-rich 10 (Transformer-2 protein homolog B) (SFRS10)

Abbreviation

Recombinant Human TRA2B protein, partial

Gene Name

TRA2B

UniProt

P62995

Expression Region

111-201aa

Organism

Homo sapiens (Human)

Target Sequence

RANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHT

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing. Can either activate or suppress exon inclusion. Acts additively with RBMX to promote exon 7 inclusion of the survival motor neuron SMN2. Activates the splicing of MAPT/Tau exon 10. Alters pre-mRNA splicing patterns by antagonizing the effects of splicing regulators, like RBMX. Binds to the AG-rich SE2 domain in the SMN exon 7 RNA. Binds to pre-mRNA.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing. Can either activate or suppress exon inclusion. Acts additively with RBMX to promote exon 7 inclusion of the survival motor neuron SMN2. Activates the splicing of MAPT/Tau exon 10. Alters pre-mRNA splicing patterns by antagonizing the effects of splicing regulators, like RBMX. Binds to the AG-rich SE2 domain in the SMN exon 7 RNA. Binds to pre-mRNA.

Molecular Weight

26.5 kDa

References & Citations

"Human transformer-2-beta gene (SFRS10) : complete nucleotide sequence, chromosomal localization, and generation of a tissue-specific isoform." Nayler O., Cap C., Stamm S. Genomics 53:191-202 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

EPB41 Protein Vector (Human) (pPM-C-HA)
19337022 500 ng

EPB41 Protein Vector (Human) (pPM-C-HA)

Ask
View Details
Recombinant Human IL-5 Protein (His-tag)
GB300006-H-10μg 10 μg

Recombinant Human IL-5 Protein (His-tag)

Ask
View Details
Recombinant Streptococcus pneumoniae serotype 19F Triosephosphate isomerase (tpiA)
MBS1200516-01 0.02 mg (E-Coli)

Recombinant Streptococcus pneumoniae serotype 19F Triosephosphate isomerase (tpiA)

Ask
View Details
Recombinant Streptococcus pneumoniae serotype 19F Triosephosphate isomerase (tpiA)
MBS1200516-02 0.1 mg (E-Coli)

Recombinant Streptococcus pneumoniae serotype 19F Triosephosphate isomerase (tpiA)

Ask
View Details
Recombinant Streptococcus pneumoniae serotype 19F Triosephosphate isomerase (tpiA)
MBS1200516-03 0.02 mg (Yeast)

Recombinant Streptococcus pneumoniae serotype 19F Triosephosphate isomerase (tpiA)

Ask
View Details
Recombinant Streptococcus pneumoniae serotype 19F Triosephosphate isomerase (tpiA)
MBS1200516-04 0.1 mg (Yeast)

Recombinant Streptococcus pneumoniae serotype 19F Triosephosphate isomerase (tpiA)

Ask
View Details