Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Akkermansia muciniphila Crossover junction endodeoxyribonuclease RuvC (ruvC)

Product Specifications

Product Name Alternative

Holliday junction nuclease RuvC Holliday junction resolvase RuvC

Abbreviation

Recombinant Akkermansia muciniphila ruvC protein

Gene Name

RuvC

UniProt

B2UP63

Expression Region

1-167aa

Organism

Akkermansia muciniphila (strain ATCC BAA-835 / Muc)

Target Sequence

MRILAIDPAIRNTGYAVVEGDYRRARALDYGTLSIPRSVSQSGCLLAIKQHLGNLIDKWNPDEMAVERIIYVQSHQTAITMGAAKAAVVIAAAEAGLRIMEYSPKSVKLSVVGRGAAQKTQVAFMVRALLELRETPESDAADALAIGLTHLFSADPLKAHMMERKYI

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group.

Molecular Weight

23.2 kDa

References & Citations

"The genome of Akkermansia muciniphila, a dedicated intestinal mucin degrader, and its use in exploring intestinal metagenomes." van Passel M.W., Kant R., Zoetendal E.G., Plugge C.M., Derrien M., Malfatti S.A., Chain P.S., Woyke T., Palva A., de Vos W.M., Smidt H. PLoS ONE 6:E16876-E16876 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cy3 Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)
MBS2137918-01 0.1 mL

Cy3 Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)

Ask
View Details
Cy3 Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)
MBS2137918-02 0.2 mL

Cy3 Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)

Ask
View Details
Cy3 Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)
MBS2137918-03 0.5 mL

Cy3 Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)

Ask
View Details
Cy3 Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)
MBS2137918-04 1 mL

Cy3 Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)

Ask
View Details
Cy3 Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)
MBS2137918-05 5 mL

Cy3 Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)

Ask
View Details
Cy3 Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)
MBS2137918-06 5x 5 mL

Cy3 Linked Monoclonal Antibody to Semaphorin 5B (SEMA5B)

Ask
View Details