Recombinant Escherichia coli O157:H7 Large-conductance mechanosensitive channel (mscL)
Selected Variant
CSB-EP363948EODa6-01
Size: 20 µg
Product Specifications
Product Name Alternative
MscL; Z4661; ECs4156; Large-conductance mechanosensitive channel
Abbreviation
Recombinant E.coli O157:H7 mscL protein
Gene Name
MscL
UniProt
P0A743
Expression Region
1-136aa
Organism
Escherichia coli O157:H7
Target Sequence
MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLTEIRDLLKEQNNRS
Tag
N-terminal 6xHis-B2M-tagged
Type
In Stock Protein
Source
E.coli
Field of Research
Others
Relevance
Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell (By similarity) .
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell.
Molecular Weight
29 kDa
References & Citations
"Complete genome sequence of enterohemorrhagic Escherichia coli O157:H7 and genomic comparison with a laboratory strain K-12."Hayashi T., Makino K., Ohnishi M., Kurokawa K., Ishii K., Yokoyama K., Han C.-G., Ohtsubo E., Nakayama K., Murata T., Tanaka M., Tobe T., Iida T., Takami H., Honda T., Sasakawa C., Ogasawara N., Yasunaga T. Shinagawa H.DNA Res. 8:11-22 (2001)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Ephrin B2 Recombinant Rabbit Monoclonal Antibody [JM53-21]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea8192c/imageurl/et1705-33.webp)
ET1705-33 100 µL
Ephrin B2 Recombinant Rabbit Monoclonal Antibody [JM53-21]
Sign In for Pricing
View Details 
PA1639-iFluor647 100 µg
Anti-XRCC1 Antibody Picoband®, iFluor647 Conjugate
Sign In for Pricing
View Details 
BNCB1498-500 1x 500 µL
CD20 / MS4A1 (B-Cell Marker), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC403068-500 1x 500 µL
Desmoglein-1 (DSG1) (32-2B), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB0942-100 1x 100 µL
Milk Fat Globulin (EDM45), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400429-500 1x 500 µL
CD19 (CVID3/429), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details