Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Conus vexillum Alpha-conotoxin VxXXC

Product Specifications

Product Name Alternative

VxXIIC

Abbreviation

Recombinant Conus vexillum Alpha-conotoxin VxXXC protein

UniProt

P0C1W7

Expression Region

1-47aa

Organism

Conus vexillum (Flag cone)

Target Sequence

DLRQCTRNAPGSTWGRCCLNPMCGNFCCPRSGCTCAYNWRRGIYCSC

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Alpha-conotoxins act on postsynaptic membranes, they bind to the nicotinic acetylcholine receptors (nAChR) and thus inhibit them. This toxin specifically blocks mammalian neuronal nAChR of the alpha-7/CHRNA7, alpha-3-beta-2/CHRNA3-CHRNB2 and alpha-4-beta-2/CHRNA4-CHRNB2 subtypes. VxXXA and VxXXB inhibit alpha-7/CHRNA7 and alpha-3-beta-2/CHRNA3-CHRNB2 nAChR more efficiently than VxXXC. VxXXB is the most effective at inhibiting alpha-4-beta-2/CHRNA4-CHRNB2 nAChR, followed by VxXXC and VxXXA.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Alpha-conotoxins act on postsynaptic membranes, they bind to the nicotinic acetylcholine receptors (nAChR) and thus inhibit them. This toxin specifically blocks mammalian neuronal nAChR of the alpha-7/CHRNA7, alpha-3-beta-2/CHRNA3-CHRNB2 and alpha-4-beta-2/CHRNA4-CHRNB2 subtypes. VxXXA and VxXXB inhibit alpha-7/CHRNA7 and alpha-3-beta-2/CHRNA3-CHRNB2 nAChR more efficiently than VxXXC. VxXXB is the most effective at inhibiting alpha-4-beta-2/CHRNA4-CHRNB2 nAChR, followed by VxXXC and VxXXA.

Molecular Weight

25.3 kDa

References & Citations

"Identification of a novel class of nicotinic receptor antagonists: dimeric conotoxins VxXIIA, VxXIIB and VxXIIC from Conus vexillum." Loughnan M., Nicke A., Jones A., Schroeder C.I., Nevin S.T., Adams D.J., Alewood P.F., Lewis R.J. J. Biol. Chem. 281:24745-24755 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Nori® Goose Sirtuin 2 ELISA Kit
GR173056 96 Well

Nori® Goose Sirtuin 2 ELISA Kit

Ask
View Details
Rabbit Monoclonal Cystatin SN Antibody (003) [DyLight 594]
NBP2-89918DL594 0.1 mL

Rabbit Monoclonal Cystatin SN Antibody (003) [DyLight 594]

Ask
View Details
AIP (AH Receptor-interacting Protein, Aryl-hydrocarbon Receptor-interacting Protein, HBV X-associated Protein 2, XAP-2, Immunophilin Homolog ARA9, XAP2) (AP)
MBS6129923-01 0.1 mL

AIP (AH Receptor-interacting Protein, Aryl-hydrocarbon Receptor-interacting Protein, HBV X-associated Protein 2, XAP-2, Immunophilin Homolog ARA9, XAP2) (AP)

Ask
View Details
AIP (AH Receptor-interacting Protein, Aryl-hydrocarbon Receptor-interacting Protein, HBV X-associated Protein 2, XAP-2, Immunophilin Homolog ARA9, XAP2) (AP)
MBS6129923-02 5x 0.1 mL

AIP (AH Receptor-interacting Protein, Aryl-hydrocarbon Receptor-interacting Protein, HBV X-associated Protein 2, XAP-2, Immunophilin Homolog ARA9, XAP2) (AP)

Ask
View Details
Recombinant Human Humanin-like protein 8 (MTRNR2L8)
MBS1026799-01 0.02 mg (E-Coli)

Recombinant Human Humanin-like protein 8 (MTRNR2L8)

Ask
View Details
Recombinant Human Humanin-like protein 8 (MTRNR2L8)
MBS1026799-02 0.02 mg (Yeast)

Recombinant Human Humanin-like protein 8 (MTRNR2L8)

Ask
View Details