Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Variola virus 14 kDa fusion protein (A27L)

Product Specifications

Product Name Alternative

A27L; A30L14 kDa fusion protein

Abbreviation

Recombinant Variola virus A27L protein

Gene Name

A27L

UniProt

P33816

Expression Region

1-110aa

Organism

Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)

Target Sequence

MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV) . The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV) . The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion (By similarity) .

Molecular Weight

14.5 kDa

References & Citations

"Creation of a clone library of fragments from the natural variola virus and study of the structural and functional organization of viral genes from a circle of hosts." Shchelkunov S.N., Marennikova S.S., Totmenin A.V., Blinov V.M., Chizhikov V.E., Gutorov V.V., Safronov P.F., Pozdnyakov S.G., Shelukhina E.M., Gashnikov P.V., Anjaparidze O.G., Sandakhchiev L.S. Dokl. Akad. Nauk SSSR 321:402-406 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal CGREF1 Antibody (2D7)
H00010669-M01 0.1 mg

Mouse Monoclonal CGREF1 Antibody (2D7)

Ask
View Details
Bovine Cholinesterase ELISA Kit
MBS9428675-01 96 Tests

Bovine Cholinesterase ELISA Kit

Ask
View Details
Bovine Cholinesterase ELISA Kit
MBS9428675-02 5x 96 Tests

Bovine Cholinesterase ELISA Kit

Ask
View Details
SOCS4, CT (Suppressor Of Cytokine Signaling 4, SOCS-4, Suppressor of Cytokine Signaling 7, SOCS-7, SOCS7)
MBS6001997-01 0.05 mg

SOCS4, CT (Suppressor Of Cytokine Signaling 4, SOCS-4, Suppressor of Cytokine Signaling 7, SOCS-7, SOCS7)

Ask
View Details
SOCS4, CT (Suppressor Of Cytokine Signaling 4, SOCS-4, Suppressor of Cytokine Signaling 7, SOCS-7, SOCS7)
MBS6001997-02 5x 0.05 mg

SOCS4, CT (Suppressor Of Cytokine Signaling 4, SOCS-4, Suppressor of Cytokine Signaling 7, SOCS-7, SOCS7)

Ask
View Details
Zfp637 AAV Vector (Mouse) (CMV)
51060104 1 μg

Zfp637 AAV Vector (Mouse) (CMV)

Ask
View Details