Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Calcium-activated chloride channel regulator 1 (CLCA1), partial

Product Specifications

Product Name Alternative

Calcium-activated chloride channel family member 1 pCLCA1 AECC

Abbreviation

Recombinant Pig CLCA1 protein, partial

Gene Name

CLCA1

UniProt

Q9TUB5

Expression Region

46-199aa

Organism

Sus scrofa (Pig)

Target Sequence

DERLIQNIKDMVTKASPYLFEATEKRFYFKNVAILIPASWKAKPEYVKPKLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKVLQYGPQGRVFVHEWAHLRWGVFNEYNNEQKFYLSNKKEQPVICSAAIRGTNVLPQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

May be involved in mediating calcium-activated chloride conductance. May play critical roles in goblet cell metaplasia, mucus hypersecretion, cystic fibrosis and AHR. May be involved in the regulation of mucus production and/or secretion by goblet cells. Involved in the regulation of tissue inflammation in the innate immune response. May play a role as a tumor suppressor. Induces MUC5AC. Induces a cAMP-dependent chloride conductance possibly through effects on CFTR in colon carcinoma cells.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be involved in mediating calcium-activated chloride conductance. May play critical roles in goblet cell metaplasia, mucus hypersecretion, cystic fibrosis and AHR. May be involved in the regulation of mucus production and/or secretion by goblet cells. Involved in the regulation of tissue inflammation in the innate immune response. May play a role as a tumor suppressor. Induces MUC5AC. Induces a cAMP-dependent chloride conductance possibly through effects on CFTR in colon carcinoma cells.

Molecular Weight

22.8 kDa

References & Citations

"pCLCA1 lacks inherent chloride channel activity in an epithelial colon carcinoma cell line." Loewen M.E., Bekar L.K., Walz W., Forsyth G.W., Gabriel S.E. Am. J. Physiol. 287:G33-G41 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Osteoprotegerin,OPG ELISA KIT
CN-01522R1 96T

Rat Osteoprotegerin,OPG ELISA KIT

Ask
View Details
Recombinant Francisella tularensis subsp. holarctica Elongation factor Ts (tsf)
MBS1287800-01 0.02 mg (E-Coli)

Recombinant Francisella tularensis subsp. holarctica Elongation factor Ts (tsf)

Ask
View Details
Recombinant Francisella tularensis subsp. holarctica Elongation factor Ts (tsf)
MBS1287800-02 0.02 mg (Yeast)

Recombinant Francisella tularensis subsp. holarctica Elongation factor Ts (tsf)

Ask
View Details
Recombinant Francisella tularensis subsp. holarctica Elongation factor Ts (tsf)
MBS1287800-03 0.1 mg (E-Coli)

Recombinant Francisella tularensis subsp. holarctica Elongation factor Ts (tsf)

Ask
View Details
Recombinant Francisella tularensis subsp. holarctica Elongation factor Ts (tsf)
MBS1287800-04 0.1 mg (Yeast)

Recombinant Francisella tularensis subsp. holarctica Elongation factor Ts (tsf)

Ask
View Details
Recombinant Francisella tularensis subsp. holarctica Elongation factor Ts (tsf)
MBS1287800-05 0.02 mg (Baculovirus)

Recombinant Francisella tularensis subsp. holarctica Elongation factor Ts (tsf)

Ask
View Details