Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Naja kaouthia Alpha-cobratoxin

Product Specifications

Product Name Alternative

Alpha-elapitoxin-Nk2a Short name:Alpha-EPTX-Nk2a Long neurotoxin 1 Siamensis 3

Abbreviation

Recombinant Naja kaouthia Alpha-cobratoxin protein

UniProt

P01391

Expression Region

1-71aa

Organism

Naja kaouthia (Monocled cobra) (Naja siamensis)

Target Sequence

IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Monomer: binds with high affinity to muscular (alpha-1-beta-1-gamma-delta (CHRNA1/CHRNB1/CHRNG/CHRND) nAChR) (IC50=4.5 nM on Torpedo californica membranes) and neuronal alpha-7/CHRNA7 nicotinic acetylcholine receptors (IC50=105 nM) .2 Publications Homodimer: binds with high affinity (but lower than the monomeric form) to muscular (IC50=9.7 nM) and with low affinity to neuronal alpha-7/CHRNA7 nAChRs (IC50=1370 nM) .However, it acquires (compared to the monomeric form) the capacity to block alpha-3/beta-2 (CHRNA3/CHRNB2) nAChRs Heterodimer with cytotoxin 3 (AC P01446) : is slightly more active than the homodimer in inhibiting alpha-7 nAChR and is considerably more active in blocking the alpha-3-beta-2 nAChR. The monomeric form has no effect on alpha-3/beta-2 (CHRNA3/CHRNB2) nAChR. It does not show any blockade of the nicotine-evoked release of dopamine and does not affect ACh release.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Monomer

Molecular Weight

37.8 kDa

References & Citations

"Naturally occurring disulfide-bound dimers of three-fingered toxins: a paradigm for biological activity diversification." Osipov A.V., Kasheverov I.E., Makarova Y.V., Starkov V.G., Vorontsova O.V., Ziganshin R.K., Andreeva T.V., Serebryakova M.V., Benoit A., Hogg R.C., Bertrand D., Tsetlin V.I., Utkin Y.N. J. Biol. Chem. 283:14571-14580 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Claudin 1 Rabbit Polyclonal Antibody, 1 pack = 20 µL
BAL4179 1 Pack

Claudin 1 Rabbit Polyclonal Antibody, 1 pack = 20 µL

Ask
View Details
HDAC7 (NM_001098416) Human Untagged Clone
SC316282 10 µg

HDAC7 (NM_001098416) Human Untagged Clone

Ask
View Details
Human Spop (Speckle Type POZ Protein) ELISA Kit
FY-EH2424 96 Well

Human Spop (Speckle Type POZ Protein) ELISA Kit

Ask
View Details
Bovine-derived  Nucleic Acid Detection Kit (Fluorescence PCR)
TRI-B45M1 48T

Bovine-derived Nucleic Acid Detection Kit (Fluorescence PCR)

Ask
View Details