Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc ellipsosporum Cyanovirin-N

Product Specifications

Product Name Alternative

Cyanovirin-N; CV-N

Abbreviation

Recombinant Nostoc ellipsosporum Cyanovirin-N protein

UniProt

P81180

Expression Region

1-101aa

Organism

Nostoc ellipsosporum

Target Sequence

LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Its activity in situ is unknown, however it acts as a viral entry inhibitor, inhibiting HIV-1, HIV-2 and simian immunodeficiency virus (and some other viruses such as feline immunodeficiency virus, measles virus and human herpesvirus) infection and replication. It prevents essential interactions between the envelope glycoprotein and target cell receptors by binding to carbohydrates on viral protein gp120 and possibly by other mechanisms as well. Addition to cells must occur before or shortly after virus addition. It also inhibits cell-to-cell fusion, and virus-to-cell and cell-to-cell transmission of a viral infection. Is remarkably stabile; the protein can withstand multiple freeze-thaw cycles, dissolution in organic solvents, treatment with salt, detergent, H2O2 and boiling without significant loss of anti-HIV activity.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Mannose-binding lectin.

Molecular Weight

15 kDa

References & Citations

"Discovery of cyanovirin-N, a novel human immunodeficiency virus-inactivating protein that binds viral surface envelope glycoprotein gp120: potential applications to microbicide development." Boyd M.R., Gustafson K.R., McMahon J.B., Shoemaker R.H., O'Keefe B.R., Mori T., Gulakowski R.J., Wu L., Rivera M.I., Laurencot C.M., Currens M.J., Cardellina J.H. II, Buckheit R.W. Jr., Nara P.L., Pannell L.K., Sowder R.C. II, Henderson L.E. Antimicrob. Agents Chemother. 41:1521-1530 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ARPC1A, ID (Actin-related Protein 2/3 Complex Subunit 1A, SOP2-like Protein, SOP2L) (PE)
MBS6464087-01 0.2 mL

ARPC1A, ID (Actin-related Protein 2/3 Complex Subunit 1A, SOP2-like Protein, SOP2L) (PE)

Ask
View Details
ARPC1A, ID (Actin-related Protein 2/3 Complex Subunit 1A, SOP2-like Protein, SOP2L) (PE)
MBS6464087-02 5x 0.2 mL

ARPC1A, ID (Actin-related Protein 2/3 Complex Subunit 1A, SOP2-like Protein, SOP2L) (PE)

Ask
View Details
Rabbit Monoclonal TIMP-1 Antibody (TIMP1/1944R) [Alexa Fluor 700]
NBP3-08713AF700 100 µL

Rabbit Monoclonal TIMP-1 Antibody (TIMP1/1944R) [Alexa Fluor 700]

Ask
View Details
Rabbit anti-IL-1RL2 Antibody
DL97260A-01 50 µL

Rabbit anti-IL-1RL2 Antibody

Ask
View Details
Rabbit anti-IL-1RL2 Antibody
DL97260A-02 100 µL

Rabbit anti-IL-1RL2 Antibody

Ask
View Details
Paraquat Dichloride (42% w/w in Water)
TRC-P191920-2.5G 2.5 g

Paraquat Dichloride (42% w/w in Water)

Ask
View Details