Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor susceptibility gene 101 protein (TSG101), partial

Product Specifications

Product Name Alternative

ESCRT-I complex subunit TSG101

Abbreviation

Recombinant Human TSG101 protein, partial

Gene Name

TSG101

UniProt

Q99816

Expression Region

1-145aa

Organism

Homo sapiens (Human)

Target Sequence

MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs) . Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis; the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator. Involved in the budding of many viruses through an interaction with viral proteins that contain a late-budding motif P-[ST]-A-P. This interaction is essential for viral particle budding of numerous retroviruses. Required for the exosomal release of SDCBP, CD63 and syndecan

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs) . Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis; the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator. Involved in the budding of many viruses through an interaction with viral proteins that contain a late-budding motif P-[ST]-A-P. This interaction is essential for viral particle budding of numerous retroviruses. Required for the exosomal release of SDCBP, CD63 and syndecan

Molecular Weight

36.6 kDa

References & Citations

"The TSG101 tumor susceptibility gene is located in chromosome 11 band p15 and is mutated in human breast cancer." Li L., Li X., Francke U., Cohen S.N. Cell 88:143-154 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

APC-Linked Polyclonal Antibody to Laminin Beta 3 (LAMb3)
MBS2062875-01 0.1 mL

APC-Linked Polyclonal Antibody to Laminin Beta 3 (LAMb3)

Ask
View Details
APC-Linked Polyclonal Antibody to Laminin Beta 3 (LAMb3)
MBS2062875-02 0.2 mL

APC-Linked Polyclonal Antibody to Laminin Beta 3 (LAMb3)

Ask
View Details
APC-Linked Polyclonal Antibody to Laminin Beta 3 (LAMb3)
MBS2062875-03 0.5 mL

APC-Linked Polyclonal Antibody to Laminin Beta 3 (LAMb3)

Ask
View Details
APC-Linked Polyclonal Antibody to Laminin Beta 3 (LAMb3)
MBS2062875-04 1 mL

APC-Linked Polyclonal Antibody to Laminin Beta 3 (LAMb3)

Ask
View Details
APC-Linked Polyclonal Antibody to Laminin Beta 3 (LAMb3)
MBS2062875-05 5 mL

APC-Linked Polyclonal Antibody to Laminin Beta 3 (LAMb3)

Ask
View Details
APC-Linked Polyclonal Antibody to Laminin Beta 3 (LAMb3)
MBS2062875-06 5x 5 mL

APC-Linked Polyclonal Antibody to Laminin Beta 3 (LAMb3)

Ask
View Details