Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Heme oxygenase 1 (Hmox1)

Product Specifications

Product Name Alternative

P32 protein

Abbreviation

Recombinant Mouse Hmox1 protein

Gene Name

Hmox1

UniProt

P14901

Expression Region

1-289aa

Organism

Mus musculus (Mouse)

Target Sequence

MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM

Tag

N-terminal 6xHis-B2M-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.

Molecular Weight

46.9 kDa

References & Citations

"Isolation and characterization of a complementary DNA clone for a Mr 32,000 protein which is induced with tumor promoters in BALB/c 3T3 cells." Kageyama H., Hiwasa T., Tokunaga K., Sakiyama S. Cancer Res. 48:4795-4798 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Doublesex- and mab-3-related transcription factor 1 (DMRT1) ELISA Kit
MBS7236146-01 48 Well

Mouse Doublesex- and mab-3-related transcription factor 1 (DMRT1) ELISA Kit

Ask
View Details
Mouse Doublesex- and mab-3-related transcription factor 1 (DMRT1) ELISA Kit
MBS7236146-02 96 Well

Mouse Doublesex- and mab-3-related transcription factor 1 (DMRT1) ELISA Kit

Ask
View Details
Mouse Doublesex- and mab-3-related transcription factor 1 (DMRT1) ELISA Kit
MBS7236146-03 5x 96 Well

Mouse Doublesex- and mab-3-related transcription factor 1 (DMRT1) ELISA Kit

Ask
View Details
Mouse Doublesex- and mab-3-related transcription factor 1 (DMRT1) ELISA Kit
MBS7236146-04 10x 96 Well

Mouse Doublesex- and mab-3-related transcription factor 1 (DMRT1) ELISA Kit

Ask
View Details
Trex2 Rat shRNA Lentiviral Particle (Locus ID 309275)
TL706134V 500 µL Each

Trex2 Rat shRNA Lentiviral Particle (Locus ID 309275)

Ask
View Details
Rabbit anti-PAX6 Antibody
YLD5958-01 50 µL

Rabbit anti-PAX6 Antibody

Ask
View Details