Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (Bnip3), partial

Product Specifications

Product Name Alternative

Nip3

Abbreviation

Recombinant Mouse Bnip3 protein, partial

Gene Name

Bnip3

UniProt

O55003

Expression Region

1-156aa

Organism

Mus musculus (Mouse)

Target Sequence

MSQSGEENLQGSWVELHFSNGNGSSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRAEIDSHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSADFLK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Apoptosis-inducing protein that can overcome BCL2 suppression. May play a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. Involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates in mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane may play a critical role in the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane regulates the opening of a pore in the mitochondrial double membrane in order to mediate the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix (By similarity) . Plays an important role in the calprotectin (S100A8/A9) -induced cell death pathway

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Apoptosis-inducing protein that can overcome BCL2 suppression. May play a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2 (By similarity) . Involved in mitochondrial quality control via its interaction with SPATA18/MIEAP

Molecular Weight

21.6 kDa

References & Citations

"Nix and Nip3 form a subfamily of pro-apoptotic mitochondrial proteins." Chen G., Cizeau J., Vande Velde C., Park J.H., Bozek G., Bolton J., Shi L., Dubik D., Greenberg A. J. Biol. Chem. 274:7-10 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Toe1 (NM_001106680) Rat Tagged ORF Clone Lentiviral Particle
RR207881L3V 200 µL

Toe1 (NM_001106680) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
DNAJC30 Protein Vector (Human) (pPM-C-HA)
18412021 500 ng

DNAJC30 Protein Vector (Human) (pPM-C-HA)

Ask
View Details
Complement C4-B (C4B) Polyclonal Antibody
CAU31383-01 100 µL

Complement C4-B (C4B) Polyclonal Antibody

Ask
View Details
Complement C4-B (C4B) Polyclonal Antibody
CAU31383-02 200 µL

Complement C4-B (C4B) Polyclonal Antibody

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 16 (CCL16)
MBS2051784-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 16 (CCL16)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 16 (CCL16)
MBS2051784-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 16 (CCL16)

Ask
View Details