Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Staphylococcal complement inhibitor (scn)

Product Specifications

Product Name Alternative

Scn; SA1754; Staphylococcal complement inhibitor; SCIN

Abbreviation

Recombinant Staphylococcus aureus scn protein

Gene Name

Scn

UniProt

Q99SU9

Expression Region

32-116aa

Organism

Staphylococcus aureus (strain N315)

Target Sequence

STSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGLKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Involved in countering the first line of host defense mechanisms. Efficiently inhibits opsonization, phagocytosis and killing of S.aureus by human neutrophils. Acts by binding and stabilizing human C3 convertases (C4b2a and C3bBb), leading to their inactivation. The convertases are no longer able to cleave complement C3, therefore preventing further C3b deposition on the bacterial surface and phagocytosis of the bacterium. Also prevents C5a-induced neutrophil responses

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in countering the first line of host defense mechanisms. Efficiently inhibits opsonization, phagocytosis and killing of S.aureus by human neutrophils. Acts by binding and stabilizing human C3 convertases (C4b2a and C3bBb), leading to their inactivation. The convertases are no longer able to cleave complement C3, therefore preventing further C3b deposition on the bacterial surface and phagocytosis of the bacterium. Also prevents C5a-induced neutrophil responses (By similarity) .

Molecular Weight

12.3 kDa

References & Citations

"Whole genome sequencing of meticillin-resistant Staphylococcus aureus." Kuroda M., Ohta T., Uchiyama I., Baba T., Yuzawa H., Kobayashi I., Cui L., Oguchi A., Aoki K., Nagai Y., Lian J.-Q., Ito T., Kanamori M., Matsumaru H., Maruyama A., Murakami H., Hosoyama A., Mizutani-Ui Y.Hiramatsu K. Lancet 357:1225-1240 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

C14orf37 (ARMH4) (NM_001001872) Human Tagged ORF Clone Lentiviral Particle
RC215970L3V 200 µL

C14orf37 (ARMH4) (NM_001001872) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
JAKMIP1 Peptide (AAP41125)
AAP41125-100UG 100 µg

JAKMIP1 Peptide (AAP41125)

Ask
View Details
Rabbit Polyclonal WASP Antibody [mFluor Violet 500 SE]
NBP2-99085MFV500 0.1 mL

Rabbit Polyclonal WASP Antibody [mFluor Violet 500 SE]

Ask
View Details
p16 Polyclonal Antibody
MBS9408132-01 0.05 mL

p16 Polyclonal Antibody

Ask
View Details
p16 Polyclonal Antibody
MBS9408132-02 0.1 mL

p16 Polyclonal Antibody

Ask
View Details
p16 Polyclonal Antibody
MBS9408132-03 5x 0.1 mL

p16 Polyclonal Antibody

Ask
View Details