Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhesus cytomegalovirus Envelope glycoprotein B (gB), partial

Product Specifications

Product Name Alternative

GB; UL55; Envelope glycoprotein B; gB

Abbreviation

Recombinant Rhesus cytomegalovirus gB protein, partial

Gene Name

GB

UniProt

P89053

Expression Region

745-854aa

Organism

Rhesus cytomegalovirus (strain 68-1) (RhCMV)

Target Sequence

MRQKRAYEKPFEHFFPYVVPPTTVKEAPPSYEQSQYENIKEKAASATKEFSLEEAYQMLLALQKLDQEKRRKAEADDEDFASNGQSAGFLDRLRNRRRGGYQKIQNEYEV

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moities of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moities of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress.

Molecular Weight

18 kDa

References & Citations

"Identification of the gene coding for rhesus cytomegalovirus glycoprotein B and immunological analysis of the protein." Kropff B., Mach M. J. Gen. Virol. 78:1999-2007 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

H1FOO, ID (H1FOO, H1OO, OSH1, Histone H1oo, Oocyte-specific histone H1, Oocyte-specific linker histone H1)
MBS6011512-01 0.2 mL

H1FOO, ID (H1FOO, H1OO, OSH1, Histone H1oo, Oocyte-specific histone H1, Oocyte-specific linker histone H1)

Ask
View Details
H1FOO, ID (H1FOO, H1OO, OSH1, Histone H1oo, Oocyte-specific histone H1, Oocyte-specific linker histone H1)
MBS6011512-02 5x 0.2 mL

H1FOO, ID (H1FOO, H1OO, OSH1, Histone H1oo, Oocyte-specific histone H1, Oocyte-specific linker histone H1)

Ask
View Details
Ethoform HSA Conjugate
B2021162 1 mg

Ethoform HSA Conjugate

Ask
View Details
Human Uncharacterized protein KIAA1614, KIAA1614 ELISA KIT
ELI-38146h 96 Tests

Human Uncharacterized protein KIAA1614, KIAA1614 ELISA KIT

Ask
View Details
Recombinant Human Fibroleukin
MBS9421143-01 0.02 mg

Recombinant Human Fibroleukin

Ask
View Details
Recombinant Human Fibroleukin
MBS9421143-02 0.1 mg

Recombinant Human Fibroleukin

Ask
View Details