Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 52 Protein E7 (E7)

Product Specifications

Product Name Alternative

E7Protein E7

Abbreviation

Recombinant Human papillomavirus type 52 E7 protein

Gene Name

E7

UniProt

P36831

Expression Region

1-99aa

Organism

Human papillomavirus type 52

Target Sequence

MRGDKATIKDYILDLQPETTDLHCYEQLGDSSDEEDTDGVDRPDGQAEQATSNYYIVTYCHSCDSTLRLCIHSTATDLRTLQQMLLGTLQVVCPGCARL

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

E7 protein has both transforming and trans-activating activities. Disrupts the function of host retinoblastoma protein RB1/pRb, which is a key regulator of the cell cycle. Induces the disassbly of the E2F1 transcription factors from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Inactivation of the ability of RB1 to arrest the cell cycle is critical for cellular transformation, uncontrolled cellular growth and proliferation induced by viral infection. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. Interferes with histone deacetylation mediated by HDAC1 and HDAC2, leading to activation of transcription .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta) .

Molecular Weight

27 kDa

References & Citations

Interactions of SV40 large T antigen and other viral proteins with retinoblastoma tumour suppressor.Lee C., Cho Y.Rev. Med. Virol. 12:81-92 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Rpl9 Antibody (Center)
E45R31800G-1 100 ul

Mouse Rpl9 Antibody (Center)

Ask
View Details
LGALS3BP Rabbit pAb
E45R18714N 50 ul

LGALS3BP Rabbit pAb

Ask
View Details
Human DOCK10 activation kit by CRISPRa
GA110828 1 Kit

Human DOCK10 activation kit by CRISPRa

Ask
View Details
PTPA Antibody - N-terminal region: HRP (ARP62067_P050-HRP)
ARP62067_P050-HRP 100 µL

PTPA Antibody - N-terminal region: HRP (ARP62067_P050-HRP)

Ask
View Details
Rabbit Polyclonal GOLGB1/Giantin Antibody [DyLight 405]
NBP2-22323V 0.1 mL

Rabbit Polyclonal GOLGB1/Giantin Antibody [DyLight 405]

Ask
View Details