Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Melanoma-associated antigen 10 (MAGEA10)

Product Specifications

Product Name Alternative

Cancer/testis antigen 1.10

Abbreviation

Recombinant Human MAGEA10 protein

Gene Name

MAGEA10

UniProt

P43363

Expression Region

1-369aa

Organism

Homo sapiens (Human)

Target Sequence

MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQMKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILSIVFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.

Molecular Weight

46.3 kDa

References & Citations

"MAGE-A10 is a nuclear protein frequently expressed in high percentages of tumor cells in lung, skin and urothelial malignancies." Schultz-Thater E., Piscuoglio S., Iezzi G., Le Magnen C., Zajac P., Carafa V., Terracciano L., Tornillo L., Spagnoli G.C. Int. J. Cancer 129:1137-1148 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

rno-miR-483-3p miRNA Inhibitor
MIR01637 2 x 5.0 nmol

rno-miR-483-3p miRNA Inhibitor

Ask
View Details
Rat Mammary Gland Frozen Sections, Lactation D7
RF-414-L7 10 Slides

Rat Mammary Gland Frozen Sections, Lactation D7

Ask
View Details
Chromogranin A (Beta-Granin, CGA, CHGA, Chromogranin A Parathyroid Secretory Protein 1, ER-37, Pancreastatin, Parastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, SP-I, Vasostatin I or II) (Biotin)
MBS6122970-01 0.1 mL

Chromogranin A (Beta-Granin, CGA, CHGA, Chromogranin A Parathyroid Secretory Protein 1, ER-37, Pancreastatin, Parastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, SP-I, Vasostatin I or II) (Biotin)

Ask
View Details
Chromogranin A (Beta-Granin, CGA, CHGA, Chromogranin A Parathyroid Secretory Protein 1, ER-37, Pancreastatin, Parastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, SP-I, Vasostatin I or II) (Biotin)
MBS6122970-02 5x 0.1 mL

Chromogranin A (Beta-Granin, CGA, CHGA, Chromogranin A Parathyroid Secretory Protein 1, ER-37, Pancreastatin, Parastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, SP-I, Vasostatin I or II) (Biotin)

Ask
View Details
EPHA7 Colorimetric Cell-Based ELISA Kit
EKC1192 1 Kit, containing one 96 Well Plate and all necessary reagents

EPHA7 Colorimetric Cell-Based ELISA Kit

Ask
View Details