Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein Wnt-7b (WNT7B)

Product Specifications

Product Name Alternative

Protein Wnt-7b; Wingless related MMTV integration site 7B; Wingless type MMTV integration site family member 7B; WNT; WNT7B; WNT7B_HUMAN

Abbreviation

Recombinant Human WNT7B protein

Gene Name

WNT7B

UniProt

P56706

Expression Region

25-349aa

Organism

Homo sapiens (Human)

Target Sequence

ALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Stem Cells

Relevance

Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters (By similarity) .

Molecular Weight

56.3 kDa

References & Citations

"Differential expression of human Wnt genes 2, 3, 4, and 7B in human breast cell lines and normal and disease states of human breast tissue." Huguet E.L., McMahon J.A., McMahon A.P., Bicknell R., Harris A.L. Cancer Res. 54:2615-2621 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BCA-1 Human, Recombinant (B Cell Attracting Chemokine1, B Lymphocyte Chemoattractant, BLC, CXCL13, BLR1 Ligand) (PE)
MBS6465041-01 0.1 mL

BCA-1 Human, Recombinant (B Cell Attracting Chemokine1, B Lymphocyte Chemoattractant, BLC, CXCL13, BLR1 Ligand) (PE)

Ask
View Details
BCA-1 Human, Recombinant (B Cell Attracting Chemokine1, B Lymphocyte Chemoattractant, BLC, CXCL13, BLR1 Ligand) (PE)
MBS6465041-02 5x 0.1 mL

BCA-1 Human, Recombinant (B Cell Attracting Chemokine1, B Lymphocyte Chemoattractant, BLC, CXCL13, BLR1 Ligand) (PE)

Ask
View Details
Rabbit anti-human MAP/microtubule affinity-regulating kinase 2 polyclonal Antibody
MBS711574-01 0.1 mL

Rabbit anti-human MAP/microtubule affinity-regulating kinase 2 polyclonal Antibody

Ask
View Details
Rabbit anti-human MAP/microtubule affinity-regulating kinase 2 polyclonal Antibody
MBS711574-02 5x 0.1 mL

Rabbit anti-human MAP/microtubule affinity-regulating kinase 2 polyclonal Antibody

Ask
View Details
DDX60L Human siRNA Oligo Duplex (Locus ID 91351)
SR314082 1 Kit

DDX60L Human siRNA Oligo Duplex (Locus ID 91351)

Ask
View Details