Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP synthase subunit delta, mitochondrial (ATP5D)

Product Specifications

Product Name Alternative

F-ATPase delta subunit

Abbreviation

Recombinant Human ATP5D protein

Gene Name

ATP5D

UniProt

P30049

Expression Region

23-168aa

Organism

Homo sapiens (Human)

Target Sequence

AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Tags & Cell Markers

Relevance

Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F1 domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha3beta3 subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Mitochondrial membrane ATP synthase (F (1) F (0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F (1) - containing the extramembraneous catalytic core, and F (0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F (1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F (1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha (3) beta (3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.

Molecular Weight

18.5 kDa

References & Citations

"Human liver protein map: a reference database established by microsequencing and gel comparison." Hochstrasser D.F., Frutiger S., Paquet N., Bairoch A., Ravier F., Pasquali C., Sanchez J.-C., Tissot J.-D., Bjellqvist B., Vargas R., Appel R.D., Hughes G.J. Electrophoresis 13:992-1001 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HBP1 Antibody
A22229-50UG 50 µg

HBP1 Antibody

Ask
View Details
Evx2 Antibody
57-613 400 µL

Evx2 Antibody

Ask
View Details
PE-Linked Polyclonal Antibody to Lens Epithelium Derived Growth Factor (LEDGF)
MBS2078506-01 0.1 mL

PE-Linked Polyclonal Antibody to Lens Epithelium Derived Growth Factor (LEDGF)

Ask
View Details
PE-Linked Polyclonal Antibody to Lens Epithelium Derived Growth Factor (LEDGF)
MBS2078506-02 0.2 mL

PE-Linked Polyclonal Antibody to Lens Epithelium Derived Growth Factor (LEDGF)

Ask
View Details
PE-Linked Polyclonal Antibody to Lens Epithelium Derived Growth Factor (LEDGF)
MBS2078506-03 0.5 mL

PE-Linked Polyclonal Antibody to Lens Epithelium Derived Growth Factor (LEDGF)

Ask
View Details
PE-Linked Polyclonal Antibody to Lens Epithelium Derived Growth Factor (LEDGF)
MBS2078506-04 1 mL

PE-Linked Polyclonal Antibody to Lens Epithelium Derived Growth Factor (LEDGF)

Ask
View Details