Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Frataxin, mitochondrial (Fxn)

Product Specifications

Product Name Alternative

FxnFrataxin; mitochondrial; Fxn; EC 1.16.3.1) [Cleaved into: Frataxin intermediate form; Frataxin mature form]

Abbreviation

Recombinant Rat Fxn protein

Gene Name

Fxn

UniProt

D3ZYW7

Expression Region

41-208aa

Organism

Rattus norvegicus (Rat)

Target Sequence

LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Tags & Cell Markers

Relevance

Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe (2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe (2+) to Fe (3+) ; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1 (By similarity) .

Molecular Weight

22.1 kDa

References & Citations

"Alpha-lipoic acid prevents mitochondrial damage and neurotoxicity in experimental chemotherapy neuropathy." Melli G., Taiana M., Camozzi F., Triolo D., Podini P., Quattrini A., Taroni F., Lauria G. Exp. Neurol. 214:276-284 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FGF-2 (r)-PR
sc-108055-PR 10 µM, 20 µL

FGF-2 (r)-PR

Ask
View Details
CAT siRNA Oligos set (Human)
15086171 3 x 5 nmol

CAT siRNA Oligos set (Human)

Ask
View Details
PLIN3 Antibody
A73857-50UL 50 µL

PLIN3 Antibody

Ask
View Details
Fam8a1 (NM_001033192) Mouse Tagged Lenti ORF Clone
MR213943L4 10 µg

Fam8a1 (NM_001033192) Mouse Tagged Lenti ORF Clone

Ask
View Details
Human SERPINA2 Recombinant Protein
PPT-15183 100 µg

Human SERPINA2 Recombinant Protein

Ask
View Details
IFN-γ (E-10) Alexa Fluor® 790
sc-373727 AF790 200 µg/mL

IFN-γ (E-10) Alexa Fluor® 790

Ask
View Details