Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear inhibitor of protein phosphatase 1 (PPP1R8)

Product Specifications

Product Name Alternative

Protein phosphatase 1 regulatory inhibitor subunit 8

Abbreviation

Recombinant Human PPP1R8 protein

Gene Name

PPP1R8

UniProt

Q12972

Expression Region

1-209aa

Organism

Homo sapiens (Human)

Target Sequence

MGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLILENGTHMASSDACHECKSMIAAAG

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Inhibitor subunit of the major nuclear protein phosphatase-1 (PP-1) . It has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates. May also be involved in pre-mRNA splicing. Binds DNA and might act as a transcriptional repressor. Seems to be required for cell proliferation. Isoform Gamma is a site-specific single-strand endoribonuclease that cleaves single strand RNA 3' to purines and pyrimidines in A+U-rich regions. It generates 5'-phosphate termini at the site of cleavage. This isoform does not inhibit PP-1. May be implicated in mRNA splicing.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inhibitor subunit of the major nuclear protein phosphatase-1 (PP-1) . It has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates. May also be involved in pre-mRNA splicing. Binds DNA and might act as a transcriptional repressor. Seems to be required for cell proliferation.; FUNCTION

Molecular Weight

52.1 kDa

References & Citations

"ard-1: a human gene that reverses the effects of temperature-sensitive and deletion mutations in the Escherichia coli rne gene and encodes an activity producing RNase E-like cleavages." Wang M., Cohen S.N. Proc. Natl. Acad. Sci. U.S.A. 91:10591-10595 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DNMBP (Dynamin Binding Protein, KIAA1010, TUBA) (MaxLight 650)
MBS6227289-01 0.1 mL

DNMBP (Dynamin Binding Protein, KIAA1010, TUBA) (MaxLight 650)

Ask
View Details
DNMBP (Dynamin Binding Protein, KIAA1010, TUBA) (MaxLight 650)
MBS6227289-02 5x 0.1 mL

DNMBP (Dynamin Binding Protein, KIAA1010, TUBA) (MaxLight 650)

Ask
View Details
Human AMIGO1 (Adhesion Molecule With Ig Like Domain Protein 1) ELISA Kit
EK246530 96 Well

Human AMIGO1 (Adhesion Molecule With Ig Like Domain Protein 1) ELISA Kit

Ask
View Details
Rabbit Anti-Human SLC12A5 pAb
PA9132-01 50 μL

Rabbit Anti-Human SLC12A5 pAb

Ask
View Details
Rabbit Anti-Human SLC12A5 pAb
PA9132-02 100 μL

Rabbit Anti-Human SLC12A5 pAb

Ask
View Details
Shc4 (NM_199022) Mouse Recombinant Protein
TP518423 20 µg

Shc4 (NM_199022) Mouse Recombinant Protein

Ask
View Details