Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human YEATS domain-containing protein 4 (YEATS4)

Product Specifications

Product Name Alternative

Glioma-amplified sequence 41

Abbreviation

Recombinant Human YEATS4 protein

Gene Name

YEATS4

UniProt

O95619

Expression Region

1-227aa

Organism

Homo sapiens (Human)

Target Sequence

MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.

Molecular Weight

53.5 kDa

References & Citations

"GAS41, a highly conserved protein in eukaryotic nuclei, binds to NuMA." Harborth J., Weber K., Osborn M. J. Biol. Chem. 275:31979-31985 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

YAP1 Rabbit pAb (APR18394N)
APR18394N-01 50 µL

YAP1 Rabbit pAb (APR18394N)

Ask
View Details
YAP1 Rabbit pAb (APR18394N)
APR18394N-02 100 µL

YAP1 Rabbit pAb (APR18394N)

Ask
View Details
YAP1 Rabbit pAb (APR18394N)
APR18394N-03 200 µL

YAP1 Rabbit pAb (APR18394N)

Ask
View Details
HRP-Linked Polyclonal Antibody to Nucleolin (NCL)
MBS2064229-01 0.1 mL

HRP-Linked Polyclonal Antibody to Nucleolin (NCL)

Ask
View Details
HRP-Linked Polyclonal Antibody to Nucleolin (NCL)
MBS2064229-02 0.2 mL

HRP-Linked Polyclonal Antibody to Nucleolin (NCL)

Ask
View Details
HRP-Linked Polyclonal Antibody to Nucleolin (NCL)
MBS2064229-03 0.5 mL

HRP-Linked Polyclonal Antibody to Nucleolin (NCL)

Ask
View Details