Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Charged multivesicular body protein 1b (CHMP1B)

Product Specifications

Product Name Alternative

CHMP1.5 Chromatin-modifying protein 1b

Abbreviation

Recombinant Human CHMP1B protein

Gene Name

CHMP1B

UniProt

Q7LBR1

Expression Region

1-199aa

Organism

Homo sapiens (Human)

Target Sequence

MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I, -II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses) . ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in cytokinesis. Involved in recruiting VPS4A and/or VPS4B and SPAST to the midbody of dividing cells. Involved in HIV-1 p6- and p9-dependent virus release.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I, -II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses) . ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in cytokinesis. Involved in recruiting VPS4A and/or VPS4B and SPAST to the midbody of dividing cells. Involved in HIV-1 p6- and p9-dependent virus release.

Molecular Weight

49.1 kDa

References & Citations

"C18orf2, a novel, highly conserved intronless gene within intron 5 of the GNAL gene on chromosome 18p11." Vuoristo J.T., Berrettini W.H., Ala-Kokko L. Cytogenet. Cell Genet. 93:19-22 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CASQ1 (Calsequestrin-1, Calmitin, Calsequestrin, Skeletal Muscle Isoform, CASQ) (MaxLight 490)
MBS6199911-01 0.1 mL

CASQ1 (Calsequestrin-1, Calmitin, Calsequestrin, Skeletal Muscle Isoform, CASQ) (MaxLight 490)

Ask
View Details
CASQ1 (Calsequestrin-1, Calmitin, Calsequestrin, Skeletal Muscle Isoform, CASQ) (MaxLight 490)
MBS6199911-02 5x 0.1 mL

CASQ1 (Calsequestrin-1, Calmitin, Calsequestrin, Skeletal Muscle Isoform, CASQ) (MaxLight 490)

Ask
View Details
PABIR3 Human qPCR Primer Pair (NM_138819)
HP217092 200 Reactions

PABIR3 Human qPCR Primer Pair (NM_138819)

Ask
View Details
FBXW7 Antibody, Biotin conjugated
A61750-100UG 100 µg

FBXW7 Antibody, Biotin conjugated

Ask
View Details
Rtn-1A (4A66):m-IgG Fc BP-HRP Bundle
sc-539435 1 Kit

Rtn-1A (4A66):m-IgG Fc BP-HRP Bundle

Ask
View Details