Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cold-inducible RNA-binding protein (CIRBP)

Product Specifications

Product Name Alternative

A18 hnRNP Glycine-rich RNA-binding protein CIRP

Abbreviation

Recombinant Human CIRBP protein

Gene Name

CIRBP

UniProt

Q14011

Expression Region

1-172aa

Organism

Homo sapiens (Human)

Target Sequence

MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (By similarity) . Promotes assembly of stress granules (SGs), when overexpressed.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (By similarity) . Promotes assembly of stress granules (SGs), when overexpressed.

Molecular Weight

45.6 kDa

References & Citations

"Identification of several human homologs of hamster DNA damage-inducible transcripts. Cloning and characterization of a novel UV-inducible cDNA that codes for a putative RNA-binding protein." Sheikh M.S., Carrier F., Papathanasiou M.A., Hollander M.C., Zhan Q., Yu K., Fornace A.J. Jr. J. Biol. Chem. 272:26720-26726 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

1700123O20Rik Double Nickase Plasmid (m2)
sc-425511-NIC-2 20 µg

1700123O20Rik Double Nickase Plasmid (m2)

Ask
View Details
ARHGAP11B Human shRNA Lentiviral Particle (Locus ID 89839)
TL313074V 500 µL Each

ARHGAP11B Human shRNA Lentiviral Particle (Locus ID 89839)

Ask
View Details
Rabbit Polyclonal eGFP Antibody [DyLight 594]
NBP3-06640DL594 0.1 mL

Rabbit Polyclonal eGFP Antibody [DyLight 594]

Ask
View Details
Porcine ovalbumin specific IgA (OVA sIgA) ELISA kit
EIA06751p 96 Well

Porcine ovalbumin specific IgA (OVA sIgA) ELISA kit

Ask
View Details