Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant SerRatia marcescens DNA-binding protein H-NS (hns)

Product Specifications

Product Name Alternative

Histone-like protein HLP-II

Abbreviation

Recombinant Serratia marcescens hns protein

Gene Name

Hns

UniProt

P18955

Expression Region

2-135aa

Organism

Serratia marcescens

Target Sequence

SERLKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDSQAQAEIEERTRKLQQYREMLIADGIDPNELLQTMAANKAAGKAKRARRPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Microbiology

Relevance

H-NS binds tightly to ds-DNA, increases its thermal stability and inhibits transcription. It also binds to ss-DNA and RNA but with a much lower affinity. H-NS has possible histone-like function. May be a global transcriptional regulator through its ability to bind to curved DNA sequences, which are found in regions upstream of a certain subset of promoters. It plays a role in the thermal control of pili production. It is subject to transcriptional auto-repression. It binds preferentially to the upstream region of its own gene recognizing two segments of DNA on both sides of a bend centered around -150 (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

A DNA-binding protein implicated in transcriptional repression and chromosome organization and compaction. Binds nucleation sites in AT-rich DNA and bridges them, forming higher-order nucleoprotein complexes and condensing the chromosome. As many horizontally transferred genes are AT-rich, it plays a central role in silencing foreign genes. A subset of genes are repressed by H-NS in association with other proteins (By similarity) .

Molecular Weight

17.5 kDa

References & Citations

"Characterization of the structural genes for the DNA-binding protein H-NS in Enterobacteriaceae."la Teana A., Falconi M., Scarlato V., Lammi M., Pon C.L.FEBS Lett. 244:34-38 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal PAG1 Antibody (MEM-255) [HRP]
NB500-342H 0.1 mL

Mouse Monoclonal PAG1 Antibody (MEM-255) [HRP]

Ask
View Details
ATG12, NT (APG12, APG12L, HAPG12, APG12 Autophagy 12-like, APG12-like, Apg12 (Autophagy, yeast) Homolog, Autophagy-related Protein 12)
MBS648113-01 0.2 mL

ATG12, NT (APG12, APG12L, HAPG12, APG12 Autophagy 12-like, APG12-like, Apg12 (Autophagy, yeast) Homolog, Autophagy-related Protein 12)

Ask
View Details
ATG12, NT (APG12, APG12L, HAPG12, APG12 Autophagy 12-like, APG12-like, Apg12 (Autophagy, yeast) Homolog, Autophagy-related Protein 12)
MBS648113-02 5x 0.2 mL

ATG12, NT (APG12, APG12L, HAPG12, APG12 Autophagy 12-like, APG12-like, Apg12 (Autophagy, yeast) Homolog, Autophagy-related Protein 12)

Ask
View Details
APC-Linked Polyclonal Antibody to POTE Ankyrin Domain Family, Member G (POTEG)
MBS2083918-01 0.1 mL

APC-Linked Polyclonal Antibody to POTE Ankyrin Domain Family, Member G (POTEG)

Ask
View Details
APC-Linked Polyclonal Antibody to POTE Ankyrin Domain Family, Member G (POTEG)
MBS2083918-02 0.2 mL

APC-Linked Polyclonal Antibody to POTE Ankyrin Domain Family, Member G (POTEG)

Ask
View Details
APC-Linked Polyclonal Antibody to POTE Ankyrin Domain Family, Member G (POTEG)
MBS2083918-03 0.5 mL

APC-Linked Polyclonal Antibody to POTE Ankyrin Domain Family, Member G (POTEG)

Ask
View Details