Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter pylori DNA protection during starvation protein (dps)

Product Specifications

Product Name Alternative

Bacterioferritin HP-NAP Neutrophil-activating protein A Short name:NAP A

Abbreviation

Recombinant Helicobacter pylori dps protein

Gene Name

Dps

UniProt

P43313

Expression Region

1-144aa

Organism

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Target Sequence

MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Protects DNA from oxidative damage by sequestering intracellular Fe2+ ion and storing it in the form of Fe3+ oxyhydroxide mineral. One hydrogen peroxide oxidizes two Fe2+ ions, which prevents hydroxyl radical production by the Fenton reaction (By similarity) . Required for the survival in the presence of oxidative stress. Dps is also a virulence factor that activates neutrophils, mast cells and monocytes. It binds to neutrophil-glycosphingolipids and to sulfated carbohydrates on mucin. It might have a role in the accumulation of neutrophils and monocytes at the site of infection. Induces superoxide anion generation, adhesion and chemotaxis of neutrophils, through a pertussis toxin-sensitive pathway involving MAP kinases.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Protects DNA from oxidative damage by sequestering intracellular Fe (2+) ion and storing it in the form of Fe (3+) oxyhydroxide mineral. One hydrogen peroxide oxidizes two Fe (2+) ions, which prevents hydroxyl radical production by the Fenton reaction (By similarity) . Required for the survival in the presence of oxidative stress. Dps is also a virulence factor that activates neutrophils, mast cells and monocytes. It binds to neutrophil-glycosphingolipids and to sulfated carbohydrates on mucin. It might have a role in the accumulation of neutrophils and monocytes at the site of infection. Induces superoxide anion generation, adhesion and chemotaxis of neutrophils, through a pertussis toxin-sensitive pathway involving MAP kinases.

Molecular Weight

32.9 kDa

References & Citations

"Identification of four new prokaryotic bacterioferritins, from Helicobacter pylori, Anabaena variabilis, Bacillus subtilis and Treponema pallidum, by analysis of gene sequences."Evans D.J. Jr., Evans D.G., Lampert H.C., Nakano H.Gene 153:123-127 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal MDM2/HDM2 [p Ser185] Antibody [Alexa Fluor 700]
NB100-1683AF700 0.1 mL

Rabbit Polyclonal MDM2/HDM2 [p Ser185] Antibody [Alexa Fluor 700]

Ask
View Details
Cir1 Mouse siRNA Oligo Duplex (Locus ID 66935)
SR414719 1 Kit

Cir1 Mouse siRNA Oligo Duplex (Locus ID 66935)

Ask
View Details
IRAK3 (Interleukin-1 Receptor-associated Kinase 3, IRAK-3, IL-1 Receptor-associated Kinase M, IRAK-M) (Biotin)
MBS6142502-01 0.1 mL

IRAK3 (Interleukin-1 Receptor-associated Kinase 3, IRAK-3, IL-1 Receptor-associated Kinase M, IRAK-M) (Biotin)

Ask
View Details
IRAK3 (Interleukin-1 Receptor-associated Kinase 3, IRAK-3, IL-1 Receptor-associated Kinase M, IRAK-M) (Biotin)
MBS6142502-02 5x 0.1 mL

IRAK3 (Interleukin-1 Receptor-associated Kinase 3, IRAK-3, IL-1 Receptor-associated Kinase M, IRAK-M) (Biotin)

Ask
View Details
KIT Antibody (N-term D121) Blocking Peptide
MBS9227128-01 0.5 mg

KIT Antibody (N-term D121) Blocking Peptide

Ask
View Details
KIT Antibody (N-term D121) Blocking Peptide
MBS9227128-02 5x 0.5 mg

KIT Antibody (N-term D121) Blocking Peptide

Ask
View Details