Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein S100-A9 (S100a9)

Product Specifications

Product Name Alternative

Calgranulin-B Migration inhibitory factor-related protein 14 Short name:MRP-14 Short name:p14 Myeloid-related protein 14 S100 calcium-binding protein A9

Abbreviation

Recombinant Rat S100a9 protein

Gene Name

S100a9

UniProt

P50116

Expression Region

2-113aa

Organism

Rattus norvegicus (Rat)

Target Sequence

AAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTNQDNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHSHGKGCGK

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and Extracellular domain functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The Extracellular domain functions involve proinfammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its proinflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER) . Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the proinflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn2+ which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. The iNOS-S100A8/A9 transnitrosylase complex is proposed to direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as GAPDH, NXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include

Molecular Weight

29 kDa

References & Citations

"Expression and cloning of migration inhibitory factor-related protein (MRP) 8 and MRP14 in arthritis-susceptible rats."Imamichi T., Uchida I., Wahl S.M., McCartney-Francis N.Biochem. Biophys. Res. Commun. 194:819-825 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human General Transcription Factor IIA, Polypeptide 1 (GTF2A1) ELISA Kit
RDR-GTF2A1-Hu-01 96 Tests

Human General Transcription Factor IIA, Polypeptide 1 (GTF2A1) ELISA Kit

Ask
View Details
Human General Transcription Factor IIA, Polypeptide 1 (GTF2A1) ELISA Kit
RDR-GTF2A1-Hu-02 48 Tests

Human General Transcription Factor IIA, Polypeptide 1 (GTF2A1) ELISA Kit

Ask
View Details
Mouse Monoclonal MHC Class II RT1Bu Antibody (OX-3) [Alexa Fluor 350]
NB100-65011AF350 0.25 mL

Mouse Monoclonal MHC Class II RT1Bu Antibody (OX-3) [Alexa Fluor 350]

Ask
View Details
Rat Diablo Homolog (DIABLO) Protein
abx653172-01 1 mg

Rat Diablo Homolog (DIABLO) Protein

Ask
View Details
Rat Diablo Homolog (DIABLO) Protein
abx653172-02 5 mg

Rat Diablo Homolog (DIABLO) Protein

Ask
View Details
Recombinant Neisseria meningitidis serogroup C/serotype 2a Probable rRNA maturation factor (NMC0477)
MBS1139633-01 0.02 mg (E-Coli)

Recombinant Neisseria meningitidis serogroup C/serotype 2a Probable rRNA maturation factor (NMC0477)

Ask
View Details