Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mediator of DNA damage checkpoint protein 1 (MDC1), partial

Product Specifications

Product Name Alternative

Nuclear factor with BRCT domains 1

Abbreviation

Recombinant Human MDC1 protein, partial

Gene Name

MDC1

UniProt

Q14676

Expression Region

1892-2082aa

Organism

Homo sapiens (Human)

Target Sequence

APKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Required for checkpoint mediated cell cycle arrest in response to DNA damage within both the S phase and G2/M phases of the cell cycle. May serve as a scaffold for the recruitment of DNA repair and signal transduction proteins to discrete foci of DNA damage marked by 'Ser-139' phosphorylation of histone H2AFX. Also required for downstream events subsequent to the recruitment of these proteins. These include phosphorylation and activation of the ATM, CHEK1 and CHEK2 kinases, and stabilization of TP53 and apoptosis. ATM and CHEK2 may also be activated independently by a parallel pathway mediated by TP53BP1.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Required for checkpoint mediated cell cycle arrest in response to DNA damage within both the S phase and G2/M phases of the cell cycle. May serve as a scaffold for the recruitment of DNA repair and signal transduction proteins to discrete foci of DNA damage marked by 'Ser-139' phosphorylation of histone H2AFX. Also required for downstream events subsequent to the recruitment of these proteins. These include phosphorylation and activation of the ATM, CHEK1 and CHEK2 kinases, and stabilization of TP53 and apoptosis. ATM and CHEK2 may also be activated independently by a parallel pathway mediated by TP53BP1.

Molecular Weight

22.9 kDa

References & Citations

"53BP1 and NFBD1/MDC1-Nbs1 function in parallel interacting pathways activating ataxia-telangiectasia mutated (ATM) in response to DNA damage."Mochan T.A., Venere M., DiTullio R.A. Jr., Halazonetis T.D.Cancer Res. 63:8586-8591 (2003) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Grhpr Mouse shRNA Plasmid (Locus ID 76238)
TR505131 1 Kit

Grhpr Mouse shRNA Plasmid (Locus ID 76238)

Ask
View Details
Rabbit Polyclonal PARP8 Antibody
NBP2-93551-0.02mL 0.02 mL

Rabbit Polyclonal PARP8 Antibody

Ask
View Details
Cattle DNASE1 (Deoxyribonuclease I) ELISA Kit
MBS8806938-01 48 Well

Cattle DNASE1 (Deoxyribonuclease I) ELISA Kit

Ask
View Details
Cattle DNASE1 (Deoxyribonuclease I) ELISA Kit
MBS8806938-02 96 Well

Cattle DNASE1 (Deoxyribonuclease I) ELISA Kit

Ask
View Details
Cattle DNASE1 (Deoxyribonuclease I) ELISA Kit
MBS8806938-03 5x 96 Well

Cattle DNASE1 (Deoxyribonuclease I) ELISA Kit

Ask
View Details
Cattle DNASE1 (Deoxyribonuclease I) ELISA Kit
MBS8806938-04 10x 96 Well

Cattle DNASE1 (Deoxyribonuclease I) ELISA Kit

Ask
View Details