Recombinant Rat Dipeptidyl peptidase 4 (Dpp4), partial
Product Specifications
Product Name Alternative
Bile canaliculus domain-specific membrane glycoprotein Dipeptidyl peptidase IV Short name: DPP IV GP110 glycoprotein T-cell activation antigen CD26 CD_antigen: CD26 Cleaved into the following 3 chains: Dipeptidyl peptidase 4 membrane form Alternative name (s) : Dipeptidyl peptidase IV membrane form Dipeptidyl peptidase 4 soluble form Alternative name (s) : Dipeptidyl peptidase IV soluble form Dipeptidyl peptidase 4 60KDA soluble form Alternative name (s) : Dipeptidyl peptidase IV 60KDA soluble form
Abbreviation
Recombinant Rat Dpp4 protein, partial
Gene Name
Dpp4
UniProt
P14740
Expression Region
638-767aa
Organism
Rattus norvegicus (Rat)
Target Sequence
SMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLR
Tag
N-terminal 6xHis-SUMO-tagged
Type
In Stock Protein
Source
E.coli
Field of Research
Immunology
Relevance
Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR) -mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion. In association with FAP is involved in the pericellular proteolysis of the Extracellular domain matrix (ECM), the migration and invasion of endothelial cells into the ECM. May be involved in the promotion of lymphatic endothelial cells adhesion, migration and tube formation. When overexpressed, enhanced cell proliferation, a process inhibited by GPC3. Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones. Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline.
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR) -mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion. In association with FAP is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM. May be involved in the promotion of lymphatic endothelial cells adhesion, migration and tube formation. When overexpressed, enhanced cell proliferation, a process inhibited by GPC3. Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones. Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline.
Molecular Weight
30.7 kDa
References & Citations
"Crystal structures of DPP-IV (CD26) from rat kidney exhibit flexible accommodation of peptidase-selective inhibitors."Longenecker K.L., Stewart K.D., Madar D.J., Jakob C.G., Fry E.H., Wilk S., Lin C.W., Ballaron S.J., Stashko M.A., Lubben T.H., Yong H., Pireh D., Pei Z., Basha F., Wiedeman P.E., von Geldern T.W., Trevillyan J.M., Stoll V.S.Biochemistry 45:7474-7482 (2006) .
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Partial
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items