Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max Cell division cycle protein 48 homolog (CDC48), partial

Product Specifications

Product Name Alternative

Valosin-containing protein homolog Short name: VCP

Abbreviation

Recombinant Glycine max CDC48 protein, partial

Gene Name

CDC48

UniProt

P54774

Expression Region

653-807aa

Organism

Glycine max (Soybean) (Glycine hispida)

Target Sequence

DEDSRHQIFKACLRKSPIAKNVDLRALARHTQGFSGADITEICQRACKYAIRENIEKDIERERKSRENPEAMDEDTVDDEVAEIKAAHFEESMKFARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPESGDRTTTGSDPFAASAGGADEDDLYS

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Probably functions in cell division and growth processes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Probably functions in cell division and growth processes.

Molecular Weight

33.5 kDa

References & Citations

"Identification of cDNA clones encoding valosin-containing protein and other plant plasma membrane-associated proteins by a general immunoscreening strategy."Shi J., Dixon R.A., Gonzales R.A., Kjellbom P., Bhattacharyya M.K.Proc. Natl. Acad. Sci. U.S.A. 92:4457-4461 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL
BNC470633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
BNC401045-100 1x 100 µL

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-100 1x 100 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2760), CF640R conjugate, 0.1mg/mL
BNC402760-100 1x 100 µL

BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2760), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM29 (TRIM29/1042), CF740 conjugate, 0.1mg/mL
BNC741042-500 1x 500 µL

TRIM29 (TRIM29/1042), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (2H11), CF640R conjugate, 0.1mg/mL
BNC400023-500 1x 500 µL

Thyroglobulin (2H11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details