Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli LexA repressor (lexA)

Product Specifications

Product Name Alternative

LexA; exrA; spr; tsl; umuA; b4043; JW4003LexA repressor; EC 3.4.21.88

Abbreviation

Recombinant E.coli lexA protein

Gene Name

LexA

UniProt

P0A7C2

Expression Region

1-202aa

Organism

Escherichia coli (strain K12)

Target Sequence

MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAAGEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNGDWL

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Represses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. Binds to the 16 bp palindromic sequence 5'-CTGTATATATATACAG-3'. In the presence of single-stranded DNA, RecA interacts with LexA causing an autocatalytic cleavage which disrupts the DNA-binding part of LexA, leading to derepression of the SOS regulon and eventually DNA repair. Implicated in hydroxy radical-mediated cell death induced by hydroxyurea treatment .The SOS response controls an apoptotic-like death (ALD) induced (in the absence of the mazE-mazF toxin-antitoxin module) in response to DNA damaging agents that is mediated by RecA and LexA

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Represses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. Binds to the 16 bp palindromic sequence 5'-CTGTATATATATACAG-3'. In the presence of single-stranded DNA, RecA interacts with LexA causing an autocatalytic cleavage which disrupts the DNA-binding part of LexA, leading to derepression of the SOS regulon and eventually DNA repair. Implicated in hydroxy radical-mediated cell death induced by hydroxyurea treatment

Molecular Weight

38.4 kDa

References & Citations

"Purified lexA protein is a repressor of the recA and lexA genes."Little J.W., Mount D.W., Yanisch-Perron C.R.Proc. Natl. Acad. Sci. U.S.A. 78:4199-4203 (1981)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RGD1306233 Protein Lysate (Rat) with C-HA Tag
38968036 100 μg

RGD1306233 Protein Lysate (Rat) with C-HA Tag

Ask
View Details
Poly(A) Binding Protein Cytoplasmic 1 (PABPC1) Antibody
abx340138-01 100 µg

Poly(A) Binding Protein Cytoplasmic 1 (PABPC1) Antibody

Ask
View Details
Poly(A) Binding Protein Cytoplasmic 1 (PABPC1) Antibody
abx340138-02 1 mg

Poly(A) Binding Protein Cytoplasmic 1 (PABPC1) Antibody

Ask
View Details
Duck Sex Determining Region Y Box Protein 6 ELISA Kit
MBS049745 Inquire

Duck Sex Determining Region Y Box Protein 6 ELISA Kit

Ask
View Details
Camel Acetyl Coenzyme A Carboxylase Beta (ACCB) ELISA Kit
MBS9348844-01 48 Well

Camel Acetyl Coenzyme A Carboxylase Beta (ACCB) ELISA Kit

Ask
View Details
Camel Acetyl Coenzyme A Carboxylase Beta (ACCB) ELISA Kit
MBS9348844-02 96 Well

Camel Acetyl Coenzyme A Carboxylase Beta (ACCB) ELISA Kit

Ask
View Details