Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Atypical chemokine receptor 3 (ACKR3), partial

Product Specifications

Product Name Alternative

C-X-C chemokine receptor type 7 Short name: CXC-R7 Short name: CXCR-7 Chemokine orphan receptor 1 G-protein coupled receptor 159 G-protein coupled receptor RDC1 homolog Short name: RDC-1

Abbreviation

Recombinant Human ACKR3 protein, partial

Gene Name

ACKR3

UniProt

P25106

Expression Region

1-40aa

Organism

Homo sapiens (Human)

Target Sequence

MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNK

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Acts as a receptor for chemokines CXCL11 and CXCL12/SDF1. Chemokine binding does not activate G-protein-mediated signal transduction but instead induces beta-arrestin recruitment, leading to ligand internalization and activation of MAPK signaling pathway. Required for regulation of CXCR4 protein levels in migrating interneurons, thereby adapting their chemokine responsiveness. In glioma cells, transduces signals via MEK/ERK pathway, mediating resistance to apoptosis. Promotes cell growth and survival. Not involved in cell migration, adhesion or proliferation of normal hematopoietic progenitors but activated by CXCL11 in malignant hemapoietic cells, leading to phosphorylation of ERK1/2 (MAPK3/MAPK1) and enhanced cell adhesion and migration. Plays a regulatory role in CXCR4-mediated activation of cell surface integrins by CXCL12. Required for heart valve development. Acts as coreceptor with CXCR4 for a restricted number of HIV isolates.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Acts as a receptor for chemokines CXCL11 and CXCL12/SDF1. Chemokine binding does not activate G-protein-mediated signal transduction but instead induces beta-arrestin recruitment, leading to ligand internalization and activation of MAPK signaling pathway. Required for regulation of CXCR4 protein levels in migrating interneurons, thereby adapting their chemokine responsiveness. In glioma cells, transduces signals via MEK/ERK pathway, mediating resistance to apoptosis. Promotes cell growth and survival. Not involved in cell migration, adhesion or proliferation of normal hematopoietic progenitors but activated by CXCL11 in malignant hemapoietic cells, leading to phosphorylation of ERK1/2 (MAPK3/MAPK1) and enhanced cell adhesion and migration. Plays a regulatory role in CXCR4-mediated activation of cell surface integrins by CXCL12. Required for heart valve development. Acts as coreceptor with CXCR4 for a restricted number of HIV isolates.

Molecular Weight

20.5 kDa

References & Citations

"Cloning and expression of the human vasoactive intestinal peptide receptor."Sreedharan S.P., Robichon A., Peterson K.E., Goetzl E.J.Proc. Natl. Acad. Sci. U.S.A. 88:4986-4990 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZNF3 cDNA Clone
MBS1266298-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

ZNF3 cDNA Clone

Ask
View Details
ZNF3 cDNA Clone
MBS1266298-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

ZNF3 cDNA Clone

Ask
View Details
Aldrin (HHDN) (controlled substance)
RG-A260684-01 10 mg

Aldrin (HHDN) (controlled substance)

Ask
View Details
Aldrin (HHDN) (controlled substance)
RG-A260684-02 25 mg

Aldrin (HHDN) (controlled substance)

Ask
View Details
Aldrin (HHDN) (controlled substance)
RG-A260684-03 50 mg

Aldrin (HHDN) (controlled substance)

Ask
View Details
Aldrin (HHDN) (controlled substance)
RG-A260684-04 100 mg

Aldrin (HHDN) (controlled substance)

Ask
View Details