Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Naja kaouthia Cobra venom factor, partial

Product Specifications

Product Name Alternative

Complement C3 homolog

Abbreviation

Recombinant Naja kaouthia Cobra venom factor protein, partial

UniProt

Q91132

Expression Region

733-984aa

Organism

Naja kaouthia (Monocled cobra) (Naja siamensis)

Target Sequence

DDNEDGFIADSDIISRSDFPKSWLWLTKDLTEEPNSQGISSKTMSFYLRDSITTWVVLAVSFTPTKGICVAEPYEIRVMKVFFIDLQMPYSVVKNEQVEIRAILHNYVNEDIYVRVELLYNPAFCSASTKGQRYRQQFPIKALSSRAVPFVIVPLEQGLHDVEIKASVQEALWSDGVRKKLKVVPEGVQKSIVTIVKLDPRAKGVGGTQLEVIKARKLDDRVPDTEIETKIIIQGDPVAQIIENSIDGSKLN

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Complement-activating protein in cobra venom. It is a structural and functional analog of complement component C3b, the activated form of C3. It binds factor B (CFB), which is subsequently cleaved by factor D (CFD) to form the bimolecular complex CVF/Bb. CVF/Bb is a C3/C5 convertase that cleaves both complement components C3 and C5. Structurally, it resembles the C3b degradation product C3c, which is not able to form a C3/C5 convertase. Unlike C3b/Bb, CVF/Bb is a stable complex and completely resistant to the actions of complement regulatory factors H (CFH) and I (CFI) . Therefore, CVF continuously activates complement resulting in the depletion of complement activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Complement-activating protein in cobra venom. It is a structural and functional analog of complement component C3b, the activated form of C3. It binds factor B (CFB), which is subsequently cleaved by factor D (CFD) to form the bimolecular complex CVF/Bb. CVF/Bb is a C3/C5 convertase that cleaves both complement components C3 and C5. Structurally, it resembles the C3b degradation product C3c, which is not able to form a C3/C5 convertase. Unlike C3b/Bb, CVF/Bb is a stable complex and completely resistant to the actions of complement regulatory factors H (CFH) and I (CFI) . Therefore, CVF continuously activates complement resulting in the depletion of complement activity.

Molecular Weight

55.4 kDa

References & Citations

"Molecular cloning and derived primary structure of cobra venom factor."Fritzinger D.C., Bredehorst R., Vogel C.-W.Proc. Natl. Acad. Sci. U.S.A. 91:12775-12779 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Activity Regulated Cytoskeleton Associated Protein (ARC) ELISA Kit
MBS2706732-01 24 Strip Well

Rat Activity Regulated Cytoskeleton Associated Protein (ARC) ELISA Kit

Ask
View Details
Rat Activity Regulated Cytoskeleton Associated Protein (ARC) ELISA Kit
MBS2706732-02 48 Well

Rat Activity Regulated Cytoskeleton Associated Protein (ARC) ELISA Kit

Ask
View Details
Rat Activity Regulated Cytoskeleton Associated Protein (ARC) ELISA Kit
MBS2706732-03 96 Well

Rat Activity Regulated Cytoskeleton Associated Protein (ARC) ELISA Kit

Ask
View Details
Rat Activity Regulated Cytoskeleton Associated Protein (ARC) ELISA Kit
MBS2706732-04 5x 96 Well

Rat Activity Regulated Cytoskeleton Associated Protein (ARC) ELISA Kit

Ask
View Details
Rat Activity Regulated Cytoskeleton Associated Protein (ARC) ELISA Kit
MBS2706732-05 10x 96 Well

Rat Activity Regulated Cytoskeleton Associated Protein (ARC) ELISA Kit

Ask
View Details
STNL W027-150x50-PE-CRD/1 AC Signs
830350 Card of 1 Pictogram(s)

STNL W027-150x50-PE-CRD/1 AC Signs

Ask
View Details