Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Sucrose-phosphate synthase 1 (SPS1), partial

Product Specifications

Product Name Alternative

Sucrose-phosphate synthase 1F Short name: AtSPS1F Sucrose-phosphate synthase 5.1 Short name: AtSPS5.1 UDP-glucose-fructose-phosphate glucosyltransferase

Abbreviation

Recombinant Mouse-ear cress SPS1 protein, partial

Gene Name

SPS1

UniProt

Q94BT0

Expression Region

768-995aa

Organism

Arabidopsis thaliana (Mouse-ear cress)

Target Sequence

VVIALDFDGEEDTLEATKRILDAVEKERAEGSVGFILSTSLTISEVQSFLVSGGLNPNDFDAFICNSGSDLHYTSLNNEDGPFVVDFYYHSHIEYRWGGEGLRKTLIRWASSLNEKKADNDEQIVTLAEHLSTDYCYTFTVKKPAAVPPVRELRKLLRIQALRCHVVYSQNGTRINVIPVLASRIQALRYLFVRWGIDMAKMAVFVGESGDTDYEGLLGGLHKSVVLK

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Plays a major role in photosynthetic sucrose synthesis by catalyzing the rate-limiting step of sucrose biosynthesis from UDP-glucose and fructose- 6-phosphate. Involved in the regulation of carbon partitioning in the leaves of plants. May regulate the synthesis of sucrose and therefore play a major role as a limiting factor in the export of photoassimilates out of the leaf. Plays a role for sucrose availability that is essential for plant growth and fiber elongation. Required for nectar secretion.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a major role in photosynthetic sucrose synthesis by catalyzing the rate-limiting step of sucrose biosynthesis from UDP-glucose and fructose- 6-phosphate. Involved in the regulation of carbon partitioning in the leaves of plants. May regulate the synthesis of sucrose and therefore play a major role as a limiting factor in the export of photoassimilates out of the leaf. Plays a role for sucrose availability that is essential for plant growth and fiber elongation. Required for nectar secretion.

Molecular Weight

41.5 kDa

References & Citations

"Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana."Tabata S., Kaneko T., Nakamura Y., Kotani H., Kato T., Asamizu E., Miyajima N., Sasamoto S., Kimura T., Hosouchi T., Kawashima K., Kohara M., Matsumoto M., Matsuno A., Muraki A., Nakayama S., Nakazaki N., Naruo K. Fransz P.F.Nature 408:823-826 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Chloroform pure EP, BP (pharma grade), stabilized with Ethanol
LC-10195.1 25 L

Chloroform pure EP, BP (pharma grade), stabilized with Ethanol

Ask
View Details
Human/Mouse NETO2 Affinity Purified Polyclonal Ab
AF3859-SP 25 µg

Human/Mouse NETO2 Affinity Purified Polyclonal Ab

Ask
View Details
Recombinant Bovine Trafficking protein particle complex subunit 6B (TRAPPC6B)
MBS1387663-01 0.02 mg (E-Coli)

Recombinant Bovine Trafficking protein particle complex subunit 6B (TRAPPC6B)

Ask
View Details
Recombinant Bovine Trafficking protein particle complex subunit 6B (TRAPPC6B)
MBS1387663-02 0.1 mg (E-Coli)

Recombinant Bovine Trafficking protein particle complex subunit 6B (TRAPPC6B)

Ask
View Details
Recombinant Bovine Trafficking protein particle complex subunit 6B (TRAPPC6B)
MBS1387663-03 0.02 mg (Yeast)

Recombinant Bovine Trafficking protein particle complex subunit 6B (TRAPPC6B)

Ask
View Details
Recombinant Bovine Trafficking protein particle complex subunit 6B (TRAPPC6B)
MBS1387663-04 0.1 mg (Yeast)

Recombinant Bovine Trafficking protein particle complex subunit 6B (TRAPPC6B)

Ask
View Details