Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae GTP-binding protein YPT1 (YPT1)

Product Specifications

Product Name Alternative

Protein YP2 Rab GTPase YPT1 Transport GTPase YPT1

Abbreviation

Recombinant Saccharomyces cerevisiae YPT1 protein

Gene Name

YPT1

UniProt

P01123

Expression Region

1-206aa

Organism

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Target Sequence

MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. YPT1 regulates the trafficking of secretory vesicles from the endoplasmic reticulum (ER) to the Golgi. Vesicular transport depends on shuttling of YPT1 between membrane and cytosol by GDI1, probably by recycling it to its membrane of origin after a vesicle fusion event. Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum. Also involved in the recycling of membrane proteins.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. YPT1 regulates the trafficking of secretory vesicles from the endoplasmic reticulum (ER) to the Golgi. Vesicular transport depends on shuttling of YPT1 between membrane and cytosol by GDI1, probably by recycling it to its membrane of origin after a vesicle fusion event. Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum. Also involved in the recycling of membrane proteins.

Molecular Weight

25.2 kDa

References & Citations

"Functional implications of genetic interactions between genes encoding small GTPases involved in vesicular transport in yeast."Yoo J.S., Grabowski R., Xing L., Trepte H.H., Schmitt H.D., Gallwitz D.Mol. Gen. Genet. 261:80-91 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human SPARC knockout cell line
ABC-KH14495 1 Vial

Human SPARC knockout cell line

Ask
View Details
Human Neuromedin B R/NMBR Alexa Fluor 647 Antibody
IC4728R-100UG 100 µg

Human Neuromedin B R/NMBR Alexa Fluor 647 Antibody

Ask
View Details
PHYHD1 Antibody - C-terminal region: HRP (ARP71371_P050-HRP)
ARP71371_P050-HRP 100 µL

PHYHD1 Antibody - C-terminal region: HRP (ARP71371_P050-HRP)

Ask
View Details
Rabbit Procollagen Type II ELISA Kit
E04P0004-01 48 Well

Rabbit Procollagen Type II ELISA Kit

Ask
View Details
Rabbit Procollagen Type II ELISA Kit
E04P0004-02 96 Well

Rabbit Procollagen Type II ELISA Kit

Ask
View Details
PPEF-1 CRISPR Activation Plasmid (h)
sc-409561-ACT 20 µg

PPEF-1 CRISPR Activation Plasmid (h)

Ask
View Details