Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus sp. Levanase, partial

Product Specifications

Product Name Alternative

2,6-beta-D-fructan fructanohydrolase Endo-levanase

Abbreviation

Recombinant Bacillus sp. Levanase protein, partial

UniProt

O31411

Expression Region

451-579aa

Organism

Bacillus sp. (strain L7)

Target Sequence

LPWNDLGHVWSGSAVADTTNASGLFGSSGGKGLIAYYTSYNPDRHNGNQKIGLAYSTDRGRTWKYSEEHPVVIENPGKTGEDPGGWDFRDPKVVRDEANNRWVMVVSGGDHIRLFTSTNLLNWTLTDQF

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Microbiology

Relevance

Catalyzes the hydrolysis of levan with endo-type specificity. The products of levan hydrolysis are a mixture of fructose and a series of fructooligosaccharides up to 12-mer, with levantriose being the major oligosaccharide obtained. Is not active towards sucrose.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Catalyzes the hydrolysis of levan with endo-type specificity. The products of levan hydrolysis are a mixture of fructose and a series of fructooligosaccharides up to 12-mer, with levantriose being the major oligosaccharide obtained. Is not active towards sucrose.

Molecular Weight

16.3 kDa

References & Citations

"Characterization of a novel endo-levanase and its gene from Bacillus sp. L7."Miasnikov A.N.FEMS Microbiol. Lett. 154:23-28 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EHD3 Recombinant Protein Antigen
NBP2-31894PEP 0.1 mL

EHD3 Recombinant Protein Antigen

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1142895-01 0.02 mg (E-Coli)

Recombinant Helicobacter pylori Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1142895-02 0.02 mg (Yeast)

Recombinant Helicobacter pylori Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1142895-03 0.1 mg (E-Coli)

Recombinant Helicobacter pylori Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1142895-04 0.1 mg (Yeast)

Recombinant Helicobacter pylori Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1142895-05 0.02 mg (Baculovirus)

Recombinant Helicobacter pylori Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details