Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Woodchuck hepatitis B virus Protein X (X)

Product Specifications

Product Name Alternative

HBx Peptide X pX

Abbreviation

Recombinant Woodchuck hepatitis B virus protein X

Gene Name

X

UniProt

P17401

Expression Region

1-141aa

Organism

Woodchuck hepatitis B virus (isolate 8) (WHV)

Target Sequence

MAARLCCHLDSARDVLLLRPFGPQSSGPSFPRPAAGSAASSASSPSPSDESDLPLGRLPACFASASGPCCLVFTCADLRTMDSTVNFVSWHANRQLGMPSKDLWTPYIKDQLLTKWEEGSIDPRLSIFVLGGCRHKCMRLL

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Multifunctional protein that may modulate protein degradation pathways, apoptosis, transcription, signal transduction, cell cycle progress, and genetic stability by directly or indirectly interacting with hosts factors. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma) . Most of cytosolic activities involve modulation of cytosolic calcium. Effect on apoptosis is controversial depending on the cell types in which the studies have been conducted

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Multifunctional protein that plays a role in silencing host antiviral defenses and promoting viral transcription. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma) . Most of cytosolic activities involve modulation of cytosolic calcium. The effect on apoptosis is controversial depending on the cell types in which the studies have been conducted. May induce apoptosis by localizing in mitochondria and causing loss of mitochondrial membrane potential. May also modulate apoptosis by binding host CFLAR, a key regulator of the death-inducing signaling complex (DISC) . Promotes viral transcription by using the host E3 ubiquitin ligase DDB1 to target the SMC5-SMC6 complex to proteasomal degradation. This host complex would otherwise bind to viral episomal DNA, and prevents its transcription. Moderately stimulates transcription of many different viral and cellular transcription elements. Promoters and enhancers stimulated by HBx contain DNA binding sites for NF-kappa-B, AP-1, AP-2, c-EBP, ATF/CREB, or the calcium-activated factor NF-AT.

Molecular Weight

19.2 kDa

References & Citations

"Complete nucleotide sequence of a molecular clone of woodchuck hepatitis virus that is infectious in the natural host."Girones R., Cote P.J., Hornbuckle W.E., Tennant B.C., Gerin J.L., Purcell R.H., Miller R.H.Proc. Natl. Acad. Sci. U.S.A. 86:1846-1849 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Camel Papaya Proteinase I (PPI) ELISA Kit
MBS9344909-01 48 Well

Camel Papaya Proteinase I (PPI) ELISA Kit

Ask
View Details
Camel Papaya Proteinase I (PPI) ELISA Kit
MBS9344909-02 96 Well

Camel Papaya Proteinase I (PPI) ELISA Kit

Ask
View Details
Camel Papaya Proteinase I (PPI) ELISA Kit
MBS9344909-03 5x 96 Well

Camel Papaya Proteinase I (PPI) ELISA Kit

Ask
View Details
Camel Papaya Proteinase I (PPI) ELISA Kit
MBS9344909-04 10x 96 Well

Camel Papaya Proteinase I (PPI) ELISA Kit

Ask
View Details
Rat Monoclonal IFN-gamma Antibody (37895R) [Janelia Fluor 635]
FAB485RJF635 0.1 mL

Rat Monoclonal IFN-gamma Antibody (37895R) [Janelia Fluor 635]

Ask
View Details
STAU1 (C-4)
sc-390820 200 µg/mL

STAU1 (C-4)

Ask
View Details