Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Nogo-B receptor (Nus1), partial

Product Specifications

Product Name Alternative

Di-trans, poly-cis-decaprenylcistransferaseCurated Nogo-B receptorBy similarity Short name: NgBRBy similarity Nuclear undecaprenyl pyrophosphate synthase 1 homolog

Abbreviation

Recombinant Mouse Nus1 protein, partial

Gene Name

Nus1

UniProt

Q99LJ8

Expression Region

24-120aa

Organism

Mus musculus (Mouse)

Target Sequence

SWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPRAVGRNRRHHRHPHGGPGPGPGPAATHPRLRWRADVRSLQKLPVHMGLLVTEEVQEPSFSD

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

With DHDDS, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Adds multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precusrosor of dolichol which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER) . Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol. Acts as a specific receptor for the N-terminus of Nogo-B, a neural and cardiovascular regulator.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

With DHDDS, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Adds multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precursor of dolichol which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER) . Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol. Acts as a specific receptor for the N-terminus of Nogo-B, a neural and cardiovascular regulator.

Molecular Weight

13 kDa

References & Citations

"The transcriptional landscape of the mammalian genome."Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Cytoplasmic Domain

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HAS2 Antibody
A24356-100UG 100 µg

HAS2 Antibody

Ask
View Details
Zinc finger protein GLI4 (GLI4) Antibody (HRP)
abx341976-01 20 µg

Zinc finger protein GLI4 (GLI4) Antibody (HRP)

Ask
View Details
Zinc finger protein GLI4 (GLI4) Antibody (HRP)
abx341976-02 50 µg

Zinc finger protein GLI4 (GLI4) Antibody (HRP)

Ask
View Details
Zinc finger protein GLI4 (GLI4) Antibody (HRP)
abx341976-03 100 µg

Zinc finger protein GLI4 (GLI4) Antibody (HRP)

Ask
View Details
Zinc finger protein GLI4 (GLI4) Antibody (HRP)
abx341976-04 200 µg

Zinc finger protein GLI4 (GLI4) Antibody (HRP)

Ask
View Details
Zinc finger protein GLI4 (GLI4) Antibody (HRP)
abx341976-05 1 mg

Zinc finger protein GLI4 (GLI4) Antibody (HRP)

Ask
View Details