Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human BRCA1-associated protein (BRAP)

Product Specifications

Product Name Alternative

BRAP2Impedes mitogenic signal propagation ; IMPRING finger protein 52Renal carcinoma antigen NY-REN-63

Abbreviation

Recombinant Human BRAP protein

Gene Name

BRAP

UniProt

Q7Z569

Expression Region

1-592aa

Organism

Homo sapiens (Human)

Target Sequence

MSVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEASPTAQRSKDHSKECINAAPDSPSKQLPDQISFFSGNPSVEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKFVAPFNEVIEQMKIIRDSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPVEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKVAKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRDVMFYLETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRSKRGK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Negatively regulates MAP kinase activation by limiting the formation of Raf/MEK complexes probably by inactivation of the KSR1 scaffold protein. Also acts as a Ras responsive E3 ubiquitin ligase that, on activation of Ras, is modified by auto-polyubiquitination resulting in the release of inhibition of Raf/MEK complex formation. May also act as a Cytoplasmic domain retention protein with a role in regulating nuclear transport.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Negatively regulates MAP kinase activation by limiting the formation of Raf/MEK complexes probably by inactivation of the KSR1 scaffold protein. Also acts as a Ras responsive E3 ubiquitin ligase that, on activation of Ras, is modified by auto-polyubiquitination resulting in the release of inhibition of Raf/MEK complex formation. May also act as a cytoplasmic retention protein with a role in regulating nuclear transport.

Molecular Weight

69.3 kDa

References & Citations

Identification of a novel Cytoplasmic domain protein that specifically binds to nuclear localization signal motifs.Li S., Ku C.-Y., Farmer A.A., Cong Y.-S., Chen C.-F., Lee W.-H.J. Biol. Chem. 273:6183-6189 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Bovine Rho GTPase-activating protein 15 (ARHGAP15)
MBS1223186-01 0.02 mg (E-Coli)

Recombinant Bovine Rho GTPase-activating protein 15 (ARHGAP15)

Ask
View Details
Recombinant Bovine Rho GTPase-activating protein 15 (ARHGAP15)
MBS1223186-02 0.02 mg (Yeast)

Recombinant Bovine Rho GTPase-activating protein 15 (ARHGAP15)

Ask
View Details
Recombinant Bovine Rho GTPase-activating protein 15 (ARHGAP15)
MBS1223186-03 0.1 mg (E-Coli)

Recombinant Bovine Rho GTPase-activating protein 15 (ARHGAP15)

Ask
View Details
Recombinant Bovine Rho GTPase-activating protein 15 (ARHGAP15)
MBS1223186-04 0.1 mg (Yeast)

Recombinant Bovine Rho GTPase-activating protein 15 (ARHGAP15)

Ask
View Details
Recombinant Bovine Rho GTPase-activating protein 15 (ARHGAP15)
MBS1223186-05 0.02 mg (Baculovirus)

Recombinant Bovine Rho GTPase-activating protein 15 (ARHGAP15)

Ask
View Details
Recombinant Bovine Rho GTPase-activating protein 15 (ARHGAP15)
MBS1223186-06 0.02 mg (Mammalian-Cell)

Recombinant Bovine Rho GTPase-activating protein 15 (ARHGAP15)

Ask
View Details