Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Major urinary protein 11 (Mup11), partial

Product Specifications

Product Name Alternative

MUP11 and MUP8

Abbreviation

Recombinant Mouse Mup11 protein, partial

Gene Name

Mup11

UniProt

P04938

Expression Region

32-181aa

Organism

Mus musculus (Mouse)

Target Sequence

EKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Major urinary proteins (Mups) bind pheromones, and thus stabilize them to allow slow release into the air from urine marks. May protect pheromones from oxidation. May also act as pheromones themselves. In this context, they play a role in the regulation of social behaviors, such as aggression, mating, pup-suckling, territory establishment and dominance (Probable) . Binds the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT) in vitro

Molecular Weight

19.6 kDa

References & Citations

Analysis of mouse major urinary protein genes variation between the exonic sequences of group 1 genes and a comparison with an active gene out with group 1 both suggest that gene conversion has occurred between MUP genes.Clark A.J., Chave-Cox A., Ma X., Bishop J.O.EMBO J. 4:3167-3171 (1985)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MMP-10 (Hinge Region) Antibody
GWB-FD8A37 0.05 mg

MMP-10 (Hinge Region) Antibody

Ask
View Details
MAP1LC3A (D106) (LC3, APG8A, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated pro
MBS6318315-01 0.1 mL

MAP1LC3A (D106) (LC3, APG8A, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated pro

Ask
View Details
MAP1LC3A (D106) (LC3, APG8A, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated pro
MBS6318315-02 5x 0.1 mL

MAP1LC3A (D106) (LC3, APG8A, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated pro

Ask
View Details
Anti-Human CD340/ERBB2/HER2 Antibody (4D5V8), PerCP
FHC09614 100 Tests

Anti-Human CD340/ERBB2/HER2 Antibody (4D5V8), PerCP

Ask
View Details
FAM3B Antibody
E036462 100μg/100μl

FAM3B Antibody

Ask
View Details