Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis L-cystine-binding protein tcyA (tcyA)

Product Specifications

Product Name Alternative

TcyA; yckK; BSU03610; L-cystine-binding protein TcyA

Abbreviation

Recombinant Bacillus subtilis tcyA protein

Gene Name

TcyA

UniProt

P42199

Expression Region

20-268aa

Organism

Bacillus subtilis (strain 168)

Target Sequence

CGAGNDNQSKDNAKDGDLWASIKKKGVLTVGTEGTYEPFTYHDKDTDKLTGYDVEVITEVAKRLGLKVDFKETQWDSMFAGLNSKRFDVVANQVGKTDREDKYDFSDKYTTSRAVVVTKKDNNDIKSEADVKGKTSAQSLTSNYNKLATNAGAKVEGVEGMAQALQMIQQGRVDMTYNDKLAVLNYLKTSGNKNVKIAFETGEPQSTYFTFRKGSGEVVDQVNKALKEMKEDGTLSKISKKWFGEDVSK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Part of the ABC transporter complex TcyABC involved in L-cystine import.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Part of the ABC transporter complex TcyABC involved in L-cystine import.

Molecular Weight

29.6 kDa

References & Citations

The complete genome sequence of the Gram-positive bacterium Bacillus subtilis.Kunst F., Ogasawara N., Moszer I., Albertini A.M., Alloni G., Azevedo V., Bertero M.G., Bessieres P., Bolotin A., Borchert S., Borriss R., Boursier L., Brans A., Braun M., Brignell S.C., Bron S., Brouillet S., Bruschi C.V. , Caldwell B., Capuano V., Carter N.M., Choi S.-K., Codani J.-J., Connerton I.F., Cummings N.J., Daniel R.A., Denizot F., Devine K.M., Duesterhoeft A., Ehrlich S.D., Emmerson P.T., Entian K.-D., Errington J., Fabret C., Ferrari E., Foulger D., Fritz C., Fujita M., Fujita Y., Fuma S., Galizzi A., Galleron N., Ghim S.-Y., Glaser P., Goffeau A., Golightly E.J., Grandi G., Guiseppi G., Guy B.J., Haga K., Haiech J., Harwood C.R., Henaut A., Hilbert H., Holsappel S., Hosono S., Hullo M.-F., Itaya M., Jones L.-M., Joris B., Karamata D., Kasahara Y., Klaerr-Blanchard M., Klein C., Kobayashi Y., Koetter P., Koningstein G., Krogh S., Kumano M., Kurita K., Lapidus A., Lardinois S., Lauber J., Lazarevic V., Lee S.-M., Levine A., Liu H., Masuda S., Mauel C., Medigue C., Medina N., Mellado R.P., Mizuno M., Moestl D., Nakai S., Noback M., Noone D., O'Reilly M., Ogawa K., Ogiwara A., Oudega B., Park S.-H., Parro V., Pohl T.M., Portetelle D., Porwollik S., Prescott A.M., Presecan E., Pujic P., Purnelle B., Rapoport G., Rey M., Reynolds S., Rieger M., Rivolta C., Rocha E., Roche B., Rose M., Sadaie Y., Sato T., Scanlan E., Schleich S., Schroeter R., Scoffone F., Sekiguchi J., Sekowska A., Seror S.J., Serror P., Shin B.-S., Soldo B., Sorokin A., Tacconi E., Takagi T., Takahashi H., Takemaru K., Takeuchi M., Tamakoshi A., Tanaka T., Terpstra P., Tognoni A., Tosato V., Uchiyama S., Vandenbol M., Vannier F., Vassarotti A., Viari A., Wambutt R., Wedler E., Wedler H., Weitzenegger T., Winters P., Wipat A., Yamamoto H., Yamane K., Yasumoto K., Yata K., Yoshida K., Yoshikawa H.-F., Zumstein E., Yoshikawa H., Danchin A.Nature 390:249-256 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Erwinia carotovora subsp. atroseptica tRNA-modifying protein ygfZ (ECA0758)
MBS7084683-01 0.05 mg (E-Coli)

Recombinant Erwinia carotovora subsp. atroseptica tRNA-modifying protein ygfZ (ECA0758)

Ask
View Details
Recombinant Erwinia carotovora subsp. atroseptica tRNA-modifying protein ygfZ (ECA0758)
MBS7084683-02 0.2 mg (E-Coli)

Recombinant Erwinia carotovora subsp. atroseptica tRNA-modifying protein ygfZ (ECA0758)

Ask
View Details
Recombinant Erwinia carotovora subsp. atroseptica tRNA-modifying protein ygfZ (ECA0758)
MBS7084683-03 0.05 mg (Baculovirus)

Recombinant Erwinia carotovora subsp. atroseptica tRNA-modifying protein ygfZ (ECA0758)

Ask
View Details
Recombinant Erwinia carotovora subsp. atroseptica tRNA-modifying protein ygfZ (ECA0758)
MBS7084683-04 0.5 mg (E-Coli)

Recombinant Erwinia carotovora subsp. atroseptica tRNA-modifying protein ygfZ (ECA0758)

Ask
View Details
Recombinant Erwinia carotovora subsp. atroseptica tRNA-modifying protein ygfZ (ECA0758)
MBS7084683-05 0.2 mg (Yeast)

Recombinant Erwinia carotovora subsp. atroseptica tRNA-modifying protein ygfZ (ECA0758)

Ask
View Details
Recombinant Erwinia carotovora subsp. atroseptica tRNA-modifying protein ygfZ (ECA0758)
MBS7084683-06 0.05 mg (Mammalian-Cell)

Recombinant Erwinia carotovora subsp. atroseptica tRNA-modifying protein ygfZ (ECA0758)

Ask
View Details