Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Conus striatus Con-ikot-ikot

Product Specifications

Product Name Alternative

Con-ikot-ikot

Abbreviation

Recombinant Conus striatus Con-ikot-ikot protein

UniProt

P0CB20

Expression Region

38-123aa

Organism

Conus striatus (Striated cone)

Target Sequence

SGPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Potently and selectively blocks the desensitization of ionotropic glutamate AMPA receptor (GRIA1, GRIA2, GRIA3 and GRIA4) . Can also open already desensitized GRIA1 receptors. Binds to a different site than does the drug cyclothiazide . The toxin acts like a straightjacket on the ligand-binding domain (LBD) "gating ring" of the receptor, restraining the domains via both intra- and interdimer cross-links such that agonist-induced closure of the LBD "clamshells" is transduced into an irislike expansion of the gating ring . Application of the toxin to hippocampal slices causes a large and rapid increase in resting AMPAR-mediated current leading to neuronal death .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Potently and selectively blocks the desensitization of ionotropic glutamate AMPA receptor (GRIA1, GRIA2, GRIA3 and GRIA4) . Can also open already desensitized GRIA1 receptors. Binds to a different site than does the drug cyclothiazide

Molecular Weight

11.4 kDa

References & Citations

A novel Conus snail polypeptide causes excitotoxicity by blocking desensitization of AMPA receptors.Walker C.S., Jensen S., Ellison M., Matta J.A., Lee W.Y., Imperial J.S., Duclos N., Brockie P.J., Madsen D.M., Isaac J.T., Olivera B., Maricq A.V.Curr. Biol. 19:900-908 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ankyrin-1 (8C3) HRP
sc-12733 HRP 200 µg/mL

Ankyrin-1 (8C3) HRP

Ask
View Details
Tissue, Section, Matched Pairs, Human Primary and Matched Metastasis Tumor, Colon (Paraffin)
MBS640228 2x 5 Sections

Tissue, Section, Matched Pairs, Human Primary and Matched Metastasis Tumor, Colon (Paraffin)

Ask
View Details
IFluor® 450 Anti-human CD11a Antibody *R7-1*
10114040-AAT 100 Tests

IFluor® 450 Anti-human CD11a Antibody *R7-1*

Ask
View Details