Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Protransforming growth factor alpha (TGFA), partial

Product Specifications

Product Name Alternative

EGF-like TGF Short name: ETGF TGF type 1

Abbreviation

Recombinant Sheep TGFA protein, partial

Gene Name

TGFA

UniProt

P98135

Expression Region

24-97aa

Organism

Ovis aries (Sheep)

Target Sequence

ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.

Molecular Weight

34.9 kDa

References & Citations

"Growth factor expression in skin during wool follicle development."Sutton R., Ward W.G., Raphael K.A., Cam G.R.Comp. Biochem. Physiol. 110B:697-705 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tumor Necrosis Factor Receptor 1, p55 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a) (MaxLight 550)
MBS6255370-01 0.1 mL

Tumor Necrosis Factor Receptor 1, p55 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a) (MaxLight 550)

Ask
View Details
Tumor Necrosis Factor Receptor 1, p55 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a) (MaxLight 550)
MBS6255370-02 5x 0.1 mL

Tumor Necrosis Factor Receptor 1, p55 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a) (MaxLight 550)

Ask
View Details
Rabbit Polyclonal SP110 Antibody [mFluor Violet 500 SE]
NBP1-77316MFV500 0.1 mL

Rabbit Polyclonal SP110 Antibody [mFluor Violet 500 SE]

Ask
View Details
Anti-PFDN1 antibody
STJ113579 100 µl

Anti-PFDN1 antibody

Ask
View Details
Anti-FLAP / ALOX5AP (internal), Biotinylated antibody
STJ73174 100 µg

Anti-FLAP / ALOX5AP (internal), Biotinylated antibody

Ask
View Details
Rabbit Polyclonal RGS13 Antibody
NBP2-97317-50ul 50 µL

Rabbit Polyclonal RGS13 Antibody

Ask
View Details